Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
Location | 277050..277271 | Replicon | chromosome |
Accession | NZ_CP038305 | ||
Organism | Escherichia coli O157:H7 strain SS NE 1040-1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | E4U78_RS01320 | Protein ID | WP_001295224.1 |
Coordinates | 277164..277271 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 277050..277115 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U78_RS01300 | 272496..273398 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
E4U78_RS01305 | 273409..274392 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
E4U78_RS01310 | 274389..275393 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
E4U78_RS01315 | 275423..276688 | - | 1266 | WP_001481782.1 | amino acid permease | - |
- | 277050..277115 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 277050..277115 | - | 66 | NuclAT_21 | - | Antitoxin |
E4U78_RS01320 | 277164..277271 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
E4U78_RS01325 | 277358..279037 | - | 1680 | WP_000191592.1 | cellulose biosynthesis protein BcsG | - |
E4U78_RS01330 | 279034..279225 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
E4U78_RS01335 | 279222..280793 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
E4U78_RS01340 | 281066..281254 | + | 189 | WP_001063316.1 | YhjR family protein | - |
E4U78_RS01345 | 281266..281463 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
E4U78_RS01350 | 281482..282018 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T121251 WP_001295224.1 NZ_CP038305:277164-277271 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T121251 NZ_CP038305:277164-277271 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT121251 NZ_CP038305:c277115-277050 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|