Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3516061..3516286 | Replicon | chromosome |
Accession | NZ_CP038292 | ||
Organism | Escherichia coli O157:H7 strain TB21-1 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E4U65_RS18010 | Protein ID | WP_000813263.1 |
Coordinates | 3516061..3516216 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3516228..3516286 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U65_RS17975 | 3511515..3512228 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
E4U65_RS17980 | 3512366..3512562 | - | 197 | Protein_3520 | TrmB family transcriptional regulator | - |
E4U65_RS17985 | 3512849..3513667 | - | 819 | WP_171878112.1 | CPBP family intramembrane metalloprotease | - |
E4U65_RS17990 | 3513819..3514190 | - | 372 | WP_000090264.1 | antitermination protein | - |
E4U65_RS17995 | 3514180..3514551 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
E4U65_RS18000 | 3514564..3515613 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
E4U65_RS18005 | 3515615..3515893 | - | 279 | WP_001341388.1 | hypothetical protein | - |
E4U65_RS18010 | 3516061..3516216 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3516228..3516286 | + | 59 | - | - | Antitoxin |
E4U65_RS18015 | 3516318..3516455 | + | 138 | WP_000955173.1 | hypothetical protein | - |
E4U65_RS18020 | 3516821..3517594 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
E4U65_RS18025 | 3517946..3518359 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
E4U65_RS18030 | 3518375..3519145 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
E4U65_RS18035 | 3519167..3519913 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
E4U65_RS18040 | 3519920..3521011 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3481540..3530674 | 49134 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T121137 WP_000813263.1 NZ_CP038292:c3516216-3516061 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T121137 NZ_CP038292:c3516216-3516061 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT121137 NZ_CP038292:3516228-3516286 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|