Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2566410..2566631 Replicon chromosome
Accession NZ_CP038290
Organism Escherichia coli O157:H7 strain TX 265-1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag E4U08_RS13015 Protein ID WP_000170954.1
Coordinates 2566410..2566517 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2566570..2566631 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4U08_RS12990 2562255..2563337 + 1083 WP_000804726.1 peptide chain release factor 1 -
E4U08_RS12995 2563337..2564170 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
E4U08_RS13000 2564167..2564559 + 393 WP_000200379.1 invasion regulator SirB2 -
E4U08_RS13005 2564563..2565372 + 810 WP_001257044.1 invasion regulator SirB1 -
E4U08_RS13010 2565408..2566262 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
E4U08_RS13015 2566410..2566517 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2566570..2566631 + 62 NuclAT_24 - Antitoxin
- 2566570..2566631 + 62 NuclAT_24 - Antitoxin
- 2566570..2566631 + 62 NuclAT_24 - Antitoxin
- 2566570..2566631 + 62 NuclAT_24 - Antitoxin
- 2566570..2566631 + 62 NuclAT_26 - Antitoxin
- 2566570..2566631 + 62 NuclAT_26 - Antitoxin
- 2566570..2566631 + 62 NuclAT_26 - Antitoxin
- 2566570..2566631 + 62 NuclAT_26 - Antitoxin
- 2566570..2566631 + 62 NuclAT_28 - Antitoxin
- 2566570..2566631 + 62 NuclAT_28 - Antitoxin
- 2566570..2566631 + 62 NuclAT_28 - Antitoxin
- 2566570..2566631 + 62 NuclAT_28 - Antitoxin
- 2566570..2566631 + 62 NuclAT_30 - Antitoxin
- 2566570..2566631 + 62 NuclAT_30 - Antitoxin
- 2566570..2566631 + 62 NuclAT_30 - Antitoxin
- 2566570..2566631 + 62 NuclAT_30 - Antitoxin
- 2566570..2566631 + 62 NuclAT_32 - Antitoxin
- 2566570..2566631 + 62 NuclAT_32 - Antitoxin
- 2566570..2566631 + 62 NuclAT_32 - Antitoxin
- 2566570..2566631 + 62 NuclAT_32 - Antitoxin
- 2566570..2566632 + 63 NuclAT_17 - -
- 2566570..2566632 + 63 NuclAT_17 - -
- 2566570..2566632 + 63 NuclAT_17 - -
- 2566570..2566632 + 63 NuclAT_17 - -
- 2566570..2566632 + 63 NuclAT_18 - -
- 2566570..2566632 + 63 NuclAT_18 - -
- 2566570..2566632 + 63 NuclAT_18 - -
- 2566570..2566632 + 63 NuclAT_18 - -
- 2566570..2566632 + 63 NuclAT_19 - -
- 2566570..2566632 + 63 NuclAT_19 - -
- 2566570..2566632 + 63 NuclAT_19 - -
- 2566570..2566632 + 63 NuclAT_19 - -
- 2566570..2566632 + 63 NuclAT_20 - -
- 2566570..2566632 + 63 NuclAT_20 - -
- 2566570..2566632 + 63 NuclAT_20 - -
- 2566570..2566632 + 63 NuclAT_20 - -
- 2566570..2566632 + 63 NuclAT_22 - -
- 2566570..2566632 + 63 NuclAT_22 - -
- 2566570..2566632 + 63 NuclAT_22 - -
- 2566570..2566632 + 63 NuclAT_22 - -
- 2566570..2566632 + 63 NuclAT_23 - -
- 2566570..2566632 + 63 NuclAT_23 - -
- 2566570..2566632 + 63 NuclAT_23 - -
- 2566570..2566632 + 63 NuclAT_23 - -
E4U08_RS13020 2566946..2567053 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2567101..2567160 + 60 NuclAT_25 - -
- 2567101..2567160 + 60 NuclAT_25 - -
- 2567101..2567160 + 60 NuclAT_25 - -
- 2567101..2567160 + 60 NuclAT_25 - -
- 2567101..2567160 + 60 NuclAT_27 - -
- 2567101..2567160 + 60 NuclAT_27 - -
- 2567101..2567160 + 60 NuclAT_27 - -
- 2567101..2567160 + 60 NuclAT_27 - -
- 2567101..2567160 + 60 NuclAT_29 - -
- 2567101..2567160 + 60 NuclAT_29 - -
- 2567101..2567160 + 60 NuclAT_29 - -
- 2567101..2567160 + 60 NuclAT_29 - -
- 2567101..2567160 + 60 NuclAT_31 - -
- 2567101..2567160 + 60 NuclAT_31 - -
- 2567101..2567160 + 60 NuclAT_31 - -
- 2567101..2567160 + 60 NuclAT_31 - -
- 2567101..2567160 + 60 NuclAT_33 - -
- 2567101..2567160 + 60 NuclAT_33 - -
- 2567101..2567160 + 60 NuclAT_33 - -
- 2567101..2567160 + 60 NuclAT_33 - -
E4U08_RS13025 2567452..2568552 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
E4U08_RS13030 2568822..2569052 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E4U08_RS13035 2569213..2569908 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
E4U08_RS13040 2569952..2570305 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T121075 WP_000170954.1 NZ_CP038290:c2566517-2566410 [Escherichia coli O157:H7]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T121075 NZ_CP038290:c2566517-2566410 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT121075 NZ_CP038290:2566570-2566631 [Escherichia coli O157:H7]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References