Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3549653..3549878 | Replicon | chromosome |
Accession | NZ_CP038282 | ||
Organism | Escherichia coli O157:H7 strain F8492 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | E4T53_RS18305 | Protein ID | WP_000813263.1 |
Coordinates | 3549653..3549808 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3549820..3549878 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4T53_RS18270 | 3545107..3545820 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
E4T53_RS18275 | 3545958..3546154 | - | 197 | Protein_3582 | TrmB family transcriptional regulator | - |
E4T53_RS18280 | 3546441..3547259 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
E4T53_RS18285 | 3547411..3547782 | - | 372 | WP_000090264.1 | antitermination protein | - |
E4T53_RS18290 | 3547772..3548143 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
E4T53_RS18295 | 3548156..3549205 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
E4T53_RS18300 | 3549207..3549485 | - | 279 | WP_001341388.1 | hypothetical protein | - |
E4T53_RS18305 | 3549653..3549808 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3549820..3549878 | + | 59 | - | - | Antitoxin |
E4T53_RS18310 | 3549910..3550047 | + | 138 | WP_000955173.1 | hypothetical protein | - |
E4T53_RS18315 | 3550413..3551186 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
E4T53_RS18320 | 3551538..3551951 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
E4T53_RS18325 | 3551967..3552737 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
E4T53_RS18330 | 3552759..3553505 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
E4T53_RS18335 | 3553512..3554603 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T120974 WP_000813263.1 NZ_CP038282:c3549808-3549653 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T120974 NZ_CP038282:c3549808-3549653 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT120974 NZ_CP038282:3549820-3549878 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|