Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1856925..1857105 | Replicon | chromosome |
Accession | NZ_CP038270 | ||
Organism | Staphylococcus aureus strain O408 isolate B115 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SaO408_RS09245 | Protein ID | WP_001801861.1 |
Coordinates | 1856925..1857020 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1857048..1857105 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO408_RS09205 | 1851992..1852564 | + | 573 | WP_000414229.1 | hypothetical protein | - |
SaO408_RS09210 | 1852940..1853776 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
SaO408_RS09220 | 1854583..1854768 | - | 186 | WP_000809858.1 | hypothetical protein | - |
SaO408_RS09225 | 1854770..1854946 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SaO408_RS09230 | 1854957..1855340 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SaO408_RS09235 | 1856027..1856473 | - | 447 | WP_000747809.1 | DUF1433 domain-containing protein | - |
SaO408_RS09245 | 1856925..1857020 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1857048..1857105 | - | 58 | - | - | Antitoxin |
SaO408_RS09250 | 1857143..1857244 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SaO408_RS09255 | 1857282..1857398 | - | 117 | Protein_1738 | transposase | - |
SaO408_RS09260 | 1857907..1862019 | - | 4113 | WP_000831220.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T120917 WP_001801861.1 NZ_CP038270:1856925-1857020 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T120917 NZ_CP038270:1856925-1857020 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT120917 NZ_CP038270:c1857105-1857048 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|