Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2365736..2365920 | Replicon | chromosome |
Accession | NZ_CP038269 | ||
Organism | Staphylococcus aureus strain O331 isolate B114 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SaO331_RS12085 | Protein ID | WP_000482647.1 |
Coordinates | 2365813..2365920 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2365736..2365796 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO331_RS12065 | 2361246..2361413 | - | 168 | WP_031845053.1 | hypothetical protein | - |
SaO331_RS12075 | 2361644..2363377 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
SaO331_RS12080 | 2363402..2365165 | - | 1764 | WP_001064822.1 | ABC transporter ATP-binding protein/permease | - |
SaO331_RS13725 | 2365619..2365786 | - | 168 | WP_000301893.1 | hypothetical protein | - |
- | 2365736..2365796 | + | 61 | - | - | Antitoxin |
SaO331_RS12085 | 2365813..2365920 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SaO331_RS12090 | 2366053..2366439 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SaO331_RS12095 | 2366707..2367849 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SaO331_RS12100 | 2367909..2368568 | + | 660 | WP_000831298.1 | membrane protein | - |
SaO331_RS12105 | 2368751..2369962 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
SaO331_RS12110 | 2370085..2370558 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T120910 WP_000482647.1 NZ_CP038269:c2365920-2365813 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T120910 NZ_CP038269:c2365920-2365813 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT120910 NZ_CP038269:2365736-2365796 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|