Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2483647..2483831 | Replicon | chromosome |
Accession | NZ_CP038268 | ||
Organism | Staphylococcus aureus strain O55 isolate B118 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SaO55_RS12925 | Protein ID | WP_000482647.1 |
Coordinates | 2483724..2483831 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2483647..2483707 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO55_RS12900 | 2479101..2479268 | - | 168 | WP_031927726.1 | hypothetical protein | - |
SaO55_RS12910 | 2479499..2481232 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
SaO55_RS12915 | 2481257..2483020 | - | 1764 | WP_001064840.1 | ABC transporter ATP-binding protein/permease | - |
- | 2483647..2483707 | + | 61 | - | - | Antitoxin |
SaO55_RS12925 | 2483724..2483831 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SaO55_RS12930 | 2483965..2484351 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SaO55_RS12935 | 2484619..2485761 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
SaO55_RS12940 | 2485821..2486480 | + | 660 | WP_000831298.1 | membrane protein | - |
SaO55_RS12945 | 2486663..2487874 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
SaO55_RS12950 | 2487997..2488470 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sbi / hlgA / hlgC / hlgC / hlgB | 2468422..2484351 | 15929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T120900 WP_000482647.1 NZ_CP038268:c2483831-2483724 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T120900 NZ_CP038268:c2483831-2483724 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT120900 NZ_CP038268:2483647-2483707 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|