Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 1003999..1004160 | Replicon | chromosome |
Accession | NZ_CP038242 | ||
Organism | Staphylococcus warneri strain GD01 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EOJ31_RS04980 | Protein ID | WP_015364873.1 |
Coordinates | 1003999..1004094 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1004126..1004160 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EOJ31_RS04970 | 999969..1002902 | + | 2934 | WP_189723574.1 | AAA family ATPase | - |
EOJ31_RS04975 | 1002902..1003843 | + | 942 | WP_002466800.1 | 3'-5' exoribonuclease YhaM | - |
EOJ31_RS04980 | 1003999..1004094 | + | 96 | WP_015364873.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1004126..1004160 | - | 35 | - | - | Antitoxin |
EOJ31_RS04985 | 1004246..1005238 | - | 993 | WP_002466825.1 | peptidylprolyl isomerase | - |
EOJ31_RS04990 | 1005416..1005973 | - | 558 | WP_002466819.1 | DUF3267 domain-containing protein | - |
EOJ31_RS04995 | 1006168..1006539 | - | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
EOJ31_RS05000 | 1006617..1007042 | - | 426 | WP_002466803.1 | HIT family protein | - |
EOJ31_RS05005 | 1007174..1007914 | + | 741 | WP_002466806.1 | ABC transporter ATP-binding protein | - |
EOJ31_RS05010 | 1007907..1009130 | + | 1224 | WP_189723576.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3610.26 Da Isoelectric Point: 8.0878
>T120851 WP_015364873.1 NZ_CP038242:1003999-1004094 [Staphylococcus warneri]
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
>T120851 NZ_CP038242:1003999-1004094 [Staphylococcus warneri]
ATGACTGAAATCTTTGTTCATATCGCAACTACTGTTATTAGTGGTTGTATCGTTACATTATTTGCGCATTGGCTACGCCA
TCGTAACGACAAGTAA
ATGACTGAAATCTTTGTTCATATCGCAACTACTGTTATTAGTGGTTGTATCGTTACATTATTTGCGCATTGGCTACGCCA
TCGTAACGACAAGTAA
Antitoxin
Download Length: 35 bp
>AT120851 NZ_CP038242:c1004160-1004126 [Staphylococcus warneri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|