Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2471756..2471940 | Replicon | chromosome |
Accession | NZ_CP038183 | ||
Organism | Staphylococcus aureus strain MJ015 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | E3306_RS12320 | Protein ID | WP_000482652.1 |
Coordinates | 2471833..2471940 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2471756..2471816 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3306_RS12305 | 2467211..2467378 | - | 168 | WP_001789205.1 | hypothetical protein | - |
E3306_RS12310 | 2467609..2469342 | - | 1734 | WP_173950615.1 | ABC transporter ATP-binding protein/permease | - |
E3306_RS12315 | 2469367..2471130 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein/permease | - |
- | 2471756..2471816 | + | 61 | - | - | Antitoxin |
E3306_RS12320 | 2471833..2471940 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E3306_RS12325 | 2472074..2472460 | - | 387 | WP_000779357.1 | flippase GtxA | - |
E3306_RS12330 | 2472728..2473870 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
E3306_RS12335 | 2473930..2474589 | + | 660 | WP_000831298.1 | membrane protein | - |
E3306_RS12340 | 2474771..2475982 | + | 1212 | WP_001191922.1 | multidrug effflux MFS transporter | - |
E3306_RS12345 | 2476105..2476578 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T120788 WP_000482652.1 NZ_CP038183:c2471940-2471833 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T120788 NZ_CP038183:c2471940-2471833 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT120788 NZ_CP038183:2471756-2471816 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|