Detailed information of TA system TA120774

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 10597..10866
• Replicon: 2 HS-C plasmid p2HS-C-2
• Accession: NZ_CP038182
• Organism: Escherichia coli strain

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: E4F32_RS22385
• Protein ID: WP_001312861.1
• Coordinates: 10708..10866 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	10597..10662 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E4F32_RS23300	6256..6645	+	390	WP_001332050.1	outer membrane protease	-
E4F32_RS22350	7425..7583	-	159	WP_001312823.1	integrase core domain-containing protein	-
E4F32_RS22355	7767..8069	+	303	Protein_8	transposase	-
E4F32_RS22360	8163..8492	+	330	Protein_9	single-stranded DNA-binding protein	-
E4F32_RS22365	8555..8788	+	234	WP_000005990.1	DUF905 family protein	-
E4F32_RS22370	8854..9063	+	210	Protein_11	hypothetical protein	-
E4F32_RS23185	9089..9223	+	135	WP_000715153.1	hypothetical protein	-
E4F32_RS22375	9278..9712	+	435	WP_000845934.1	conjugation system SOS inhibitor PsiB	-
E4F32_RS22380	9709..10428	+	720	WP_001276228.1	plasmid SOS inhibition protein A	-
E4F32_RS23190	10440..10628	-	189	WP_001299721.1	hypothetical protein	-
-	10440..10664	+	225	NuclAT_0	-	-
-	10440..10664	+	225	NuclAT_0	-	-
-	10440..10664	+	225	NuclAT_0	-	-
-	10440..10664	+	225	NuclAT_0	-	-
-	10597..10662	+	66	-	-	Antitoxin
E4F32_RS22385	10708..10866	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
E4F32_RS23305	11161..11316	+	156	WP_032072147.1	hypothetical protein	-
E4F32_RS23310	11557..11763	+	207	WP_000547939.1	hypothetical protein	-
E4F32_RS22405	11788..12075	+	288	WP_000107535.1	hypothetical protein	-
E4F32_RS22410	12197..13018	+	822	WP_001234469.1	DUF945 domain-containing protein	-
E4F32_RS22415	13315..13917	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
E4F32_RS22420	14238..14621	+	384	WP_053320747.1	relaxosome protein TraM	-
E4F32_RS22425	14808..15497	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / sitABCD	iroN / iroE / iroD / iroC / iroB	1..115257	115257
	-	flank	IS/Tn	-	-	7767..8096	329

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T120774 WP_001312861.1 NZ_CP038182:10708-10866 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T120774 NZ_CP038182:10708-10866 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT120774 NZ_CP038182:10597-10662 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin