Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2554810..2554994 | Replicon | chromosome |
Accession | NZ_CP038021 | ||
Organism | Staphylococcus aureus strain 04-002 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | E3I93_RS13295 | Protein ID | WP_000482647.1 |
Coordinates | 2554887..2554994 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2554810..2554870 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3I93_RS13270 | 2550320..2550487 | - | 168 | Protein_2463 | hypothetical protein | - |
E3I93_RS13280 | 2550718..2552451 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
E3I93_RS13285 | 2552476..2554239 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2554810..2554870 | + | 61 | - | - | Antitoxin |
E3I93_RS13295 | 2554887..2554994 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E3I93_RS13300 | 2555128..2555514 | - | 387 | WP_000779351.1 | flippase GtxA | - |
E3I93_RS13305 | 2555782..2556924 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
E3I93_RS13310 | 2556984..2557643 | + | 660 | WP_000831298.1 | membrane protein | - |
E3I93_RS13315 | 2557825..2559036 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
E3I93_RS13320 | 2559159..2559632 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T120667 WP_000482647.1 NZ_CP038021:c2554994-2554887 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T120667 NZ_CP038021:c2554994-2554887 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT120667 NZ_CP038021:2554810-2554870 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|