Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2076704..2077003 | Replicon | chromosome |
Accession | NZ_CP038021 | ||
Organism | Staphylococcus aureus strain 04-002 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | E3I93_RS10595 | Protein ID | WP_011447039.1 |
Coordinates | 2076827..2077003 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2076704..2076761 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E3I93_RS10545 | 2072081..2072341 | + | 261 | WP_001791826.1 | hypothetical protein | - |
E3I93_RS10550 | 2072394..2072744 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
E3I93_RS10555 | 2073428..2073877 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
E3I93_RS10560 | 2073972..2074310 | - | 339 | Protein_1957 | SH3 domain-containing protein | - |
E3I93_RS10575 | 2074912..2075403 | - | 492 | WP_000920041.1 | staphylokinase | - |
E3I93_RS10580 | 2075594..2076349 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
E3I93_RS10585 | 2076361..2076615 | - | 255 | WP_000611512.1 | phage holin | - |
E3I93_RS10590 | 2076667..2076774 | + | 108 | WP_031790389.1 | hypothetical protein | - |
- | 2076696..2076835 | + | 140 | NuclAT_0 | - | - |
- | 2076696..2076835 | + | 140 | NuclAT_0 | - | - |
- | 2076696..2076835 | + | 140 | NuclAT_0 | - | - |
- | 2076696..2076835 | + | 140 | NuclAT_0 | - | - |
- | 2076704..2076761 | + | 58 | - | - | Antitoxin |
E3I93_RS10595 | 2076827..2077003 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
E3I93_RS10600 | 2077153..2077449 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
E3I93_RS10605 | 2077507..2077794 | - | 288 | WP_001040254.1 | hypothetical protein | - |
E3I93_RS10610 | 2077841..2077993 | - | 153 | WP_001153681.1 | hypothetical protein | - |
E3I93_RS10615 | 2077983..2081768 | - | 3786 | WP_134521565.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / scn / chp / sak / hlb / tsst-1 / groEL | 2066622..2138257 | 71635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T120661 WP_011447039.1 NZ_CP038021:c2077003-2076827 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T120661 NZ_CP038021:c2077003-2076827 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 58 bp
>AT120661 NZ_CP038021:2076704-2076761 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|