Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1919342..1919522 | Replicon | chromosome |
| Accession | NZ_CP038021 | ||
| Organism | Staphylococcus aureus strain 04-002 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E3I93_RS09575 | Protein ID | WP_001801861.1 |
| Coordinates | 1919342..1919437 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1919465..1919522 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3I93_RS09540 | 1914487..1915113 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| E3I93_RS09545 | 1915154..1915498 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| E3I93_RS09550 | 1915596..1916168 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| E3I93_RS09555 | 1916317..1917683 | - | 1367 | Protein_1805 | FRG domain-containing protein | - |
| E3I93_RS09560 | 1917683..1918252 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E3I93_RS09565 | 1918445..1918891 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| E3I93_RS09575 | 1919342..1919437 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1919465..1919522 | - | 58 | - | - | Antitoxin |
| E3I93_RS09580 | 1919560..1919661 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| E3I93_RS09585 | 1919836..1920278 | - | 443 | Protein_1810 | DUF1433 domain-containing protein | - |
| E3I93_RS09590 | 1920283..1920720 | - | 438 | WP_103149248.1 | DUF1433 domain-containing protein | - |
| E3I93_RS09595 | 1920720..1921162 | - | 443 | Protein_1812 | DUF1433 domain-containing protein | - |
| E3I93_RS09600 | 1921687..1924106 | + | 2420 | Protein_1813 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T120658 WP_001801861.1 NZ_CP038021:1919342-1919437 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T120658 NZ_CP038021:1919342-1919437 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT120658 NZ_CP038021:c1919522-1919465 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|