Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3431212..3431437 | Replicon | chromosome |
Accession | NZ_CP037996 | ||
Organism | Shigella flexneri strain FC906 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CBL25_RS17730 | Protein ID | WP_000813254.1 |
Coordinates | 3431212..3431367 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3431379..3431437 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBL25_RS17670 | 3426615..3426965 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
CBL25_RS24610 | 3426962..3427255 | + | 294 | WP_252997104.1 | transposase | - |
CBL25_RS24615 | 3427404..3427484 | + | 81 | WP_252997118.1 | hypothetical protein | - |
CBL25_RS17680 | 3427513..3428210 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
CBL25_RS17705 | 3428654..3429343 | - | 690 | WP_134799254.1 | bacteriophage antitermination protein Q | - |
CBL25_RS17710 | 3429340..3429705 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
CBL25_RS17715 | 3429706..3430764 | - | 1059 | WP_134799255.1 | DUF968 domain-containing protein | - |
CBL25_RS17720 | 3430766..3431044 | - | 279 | WP_011069426.1 | hypothetical protein | - |
CBL25_RS17730 | 3431212..3431367 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3431379..3431437 | + | 59 | - | - | Antitoxin |
CBL25_RS17745 | 3432018..3432434 | - | 417 | WP_005069274.1 | hypothetical protein | - |
CBL25_RS17750 | 3432461..3432601 | + | 141 | Protein_3398 | DUF4224 domain-containing protein | - |
CBL25_RS17755 | 3432601..3433648 | + | 1048 | Protein_3399 | tyrosine-type recombinase/integrase | - |
CBL25_RS17765 | 3433859..3434656 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
CBL25_RS17775 | 3434994..3436256 | + | 1263 | Protein_3401 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 3405520..3439020 | 33500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T120624 WP_000813254.1 NZ_CP037996:c3431367-3431212 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T120624 NZ_CP037996:c3431367-3431212 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT120624 NZ_CP037996:3431379-3431437 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|