Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2760244..2760469 | Replicon | chromosome |
Accession | NZ_CP037996 | ||
Organism | Shigella flexneri strain FC906 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CBL25_RS13925 | Protein ID | WP_000813254.1 |
Coordinates | 2760314..2760469 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2760244..2760302 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBL25_RS24475 | 2756247..2756416 | + | 170 | Protein_2662 | hypothetical protein | - |
CBL25_RS13890 | 2756562..2757305 | + | 744 | WP_000788999.1 | ATP-binding protein | - |
CBL25_RS13895 | 2757320..2757742 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
CBL25_RS13900 | 2757799..2758155 | + | 357 | WP_005048249.1 | hypothetical protein | - |
CBL25_RS13905 | 2758217..2758465 | + | 249 | WP_134799303.1 | DUF4014 family protein | - |
CBL25_RS13910 | 2758467..2758832 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
CBL25_RS13915 | 2758829..2759494 | + | 666 | WP_000208062.1 | hypothetical protein | - |
CBL25_RS13920 | 2759494..2759859 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 2760244..2760302 | - | 59 | - | - | Antitoxin |
CBL25_RS13925 | 2760314..2760469 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CBL25_RS13940 | 2761806..2762405 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
CBL25_RS13945 | 2762405..2762695 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
CBL25_RS13950 | 2762692..2763138 | + | 447 | Protein_2674 | DUF1133 family protein | - |
CBL25_RS13955 | 2763147..2764312 | - | 1166 | Protein_2675 | IS3 family transposase | - |
CBL25_RS13960 | 2764385..2764495 | + | 111 | Protein_2676 | DUF1133 family protein | - |
CBL25_RS13965 | 2764648..2764821 | + | 174 | WP_000504450.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 2752341..2816673 | 64332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T120613 WP_000813254.1 NZ_CP037996:2760314-2760469 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T120613 NZ_CP037996:2760314-2760469 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT120613 NZ_CP037996:c2760302-2760244 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|