Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2628490..2628710 Replicon chromosome
Accession NZ_CP037996
Organism Shigella flexneri strain FC906

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag CBL25_RS13235 Protein ID WP_000170961.1
Coordinates 2628490..2628597 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2628645..2628710 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CBL25_RS13210 (2624334) 2624334..2625416 + 1083 WP_000804726.1 peptide chain release factor 1 -
CBL25_RS13215 (2625416) 2625416..2626249 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
CBL25_RS13220 (2626246) 2626246..2626638 + 393 WP_000200378.1 invasion regulator SirB2 -
CBL25_RS13225 (2626642) 2626642..2627451 + 810 WP_001257042.1 invasion regulator SirB1 -
CBL25_RS13230 (2627487) 2627487..2628341 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CBL25_RS13235 (2628490) 2628490..2628597 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2628645) 2628645..2628710 + 66 NuclAT_16 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_16 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_16 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_16 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_17 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_17 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_17 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_17 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_18 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_18 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_18 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_18 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_19 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_19 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_19 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_19 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_20 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_20 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_20 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_20 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_21 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_21 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_21 - Antitoxin
- (2628645) 2628645..2628710 + 66 NuclAT_21 - Antitoxin
- (2628645) 2628645..2628712 + 68 NuclAT_10 - -
- (2628645) 2628645..2628712 + 68 NuclAT_10 - -
- (2628645) 2628645..2628712 + 68 NuclAT_10 - -
- (2628645) 2628645..2628712 + 68 NuclAT_10 - -
- (2628645) 2628645..2628712 + 68 NuclAT_11 - -
- (2628645) 2628645..2628712 + 68 NuclAT_11 - -
- (2628645) 2628645..2628712 + 68 NuclAT_11 - -
- (2628645) 2628645..2628712 + 68 NuclAT_11 - -
- (2628645) 2628645..2628712 + 68 NuclAT_12 - -
- (2628645) 2628645..2628712 + 68 NuclAT_12 - -
- (2628645) 2628645..2628712 + 68 NuclAT_12 - -
- (2628645) 2628645..2628712 + 68 NuclAT_12 - -
- (2628645) 2628645..2628712 + 68 NuclAT_13 - -
- (2628645) 2628645..2628712 + 68 NuclAT_13 - -
- (2628645) 2628645..2628712 + 68 NuclAT_13 - -
- (2628645) 2628645..2628712 + 68 NuclAT_13 - -
- (2628645) 2628645..2628712 + 68 NuclAT_14 - -
- (2628645) 2628645..2628712 + 68 NuclAT_14 - -
- (2628645) 2628645..2628712 + 68 NuclAT_14 - -
- (2628645) 2628645..2628712 + 68 NuclAT_14 - -
- (2628645) 2628645..2628712 + 68 NuclAT_9 - -
- (2628645) 2628645..2628712 + 68 NuclAT_9 - -
- (2628645) 2628645..2628712 + 68 NuclAT_9 - -
- (2628645) 2628645..2628712 + 68 NuclAT_9 - -
CBL25_RS13240 (2629002) 2629002..2630102 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
CBL25_RS13245 (2630372) 2630372..2630602 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CBL25_RS13250 (2630763) 2630763..2631458 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CBL25_RS13255 (2631502) 2631502..2631855 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CBL25_RS13260 (2632041) 2632041..2633435 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T120612 WP_000170961.1 NZ_CP037996:c2628597-2628490 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

>T120612 NZ_CP037996:c2628597-2628490 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT120612 NZ_CP037996:2628645-2628710 [Shigella flexneri]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References