Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30798..31067 | Replicon | plasmid pCFSAN027346-2 |
Accession | NZ_CP037947 | ||
Organism | Escherichia coli strain CFSAN027346 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EKI52_RS29775 | Protein ID | WP_001312861.1 |
Coordinates | 30909..31067 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30798..30863 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EKI52_RS29730 | 25804..26118 | + | 315 | WP_133342201.1 | hypothetical protein | - |
EKI52_RS29745 | 26591..27118 | + | 528 | WP_000290816.1 | single-stranded DNA-binding protein | - |
EKI52_RS29750 | 27174..27407 | + | 234 | WP_058653442.1 | DUF905 domain-containing protein | - |
EKI52_RS29755 | 27466..29424 | + | 1959 | WP_058653444.1 | ParB/RepB/Spo0J family partition protein | - |
EKI52_RS29760 | 29479..29913 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
EKI52_RS29765 | 29910..30629 | + | 720 | WP_033807739.1 | plasmid SOS inhibition protein A | - |
- | 30641..30865 | + | 225 | NuclAT_0 | - | - |
- | 30641..30865 | + | 225 | NuclAT_0 | - | - |
- | 30641..30865 | + | 225 | NuclAT_0 | - | - |
- | 30641..30865 | + | 225 | NuclAT_0 | - | - |
- | 30798..30863 | + | 66 | - | - | Antitoxin |
EKI52_RS29775 | 30909..31067 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
EKI52_RS29780 | 31305..31682 | - | 378 | Protein_45 | hypothetical protein | - |
EKI52_RS29790 | 31982..32278 | + | 297 | WP_001272251.1 | hypothetical protein | - |
EKI52_RS29795 | 32389..33210 | + | 822 | WP_021503380.1 | DUF945 domain-containing protein | - |
EKI52_RS29800 | 33506..34153 | - | 648 | WP_072208664.1 | transglycosylase SLT domain-containing protein | - |
EKI52_RS29805 | 34439..34822 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
EKI52_RS29810 | 35016..35702 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
EKI52_RS29815 | 35796..36023 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / dfrA8 / tet(B) | - | 1..73152 | 73152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T120533 WP_001312861.1 NZ_CP037947:30909-31067 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T120533 NZ_CP037947:30909-31067 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT120533 NZ_CP037947:30798-30863 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|