Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 81553..81806 | Replicon | plasmid pCTXM65_115068 |
Accession | NZ_CP036366 | ||
Organism | Klebsiella pneumoniae strain WCHKP115068 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | DVJ72_RS28000 | Protein ID | WP_001312851.1 |
Coordinates | 81657..81806 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 81553..81612 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DVJ72_RS27955 | 76929..77276 | + | 348 | Protein_94 | recombinase family protein | - |
DVJ72_RS27960 | 77331..78035 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
DVJ72_RS27965 | 78099..78260 | + | 162 | Protein_96 | DNA helicase | - |
DVJ72_RS27970 | 78280..79026 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
DVJ72_RS27975 | 79081..79641 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
DVJ72_RS27980 | 79773..79973 | + | 201 | WP_015059022.1 | hypothetical protein | - |
DVJ72_RS27985 | 80359..80958 | + | 600 | WP_032083981.1 | hypothetical protein | - |
DVJ72_RS27990 | 81122..81352 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 81553..81612 | - | 60 | NuclAT_0 | - | Antitoxin |
- | 81553..81612 | - | 60 | NuclAT_0 | - | Antitoxin |
- | 81553..81612 | - | 60 | NuclAT_0 | - | Antitoxin |
- | 81553..81612 | - | 60 | NuclAT_0 | - | Antitoxin |
DVJ72_RS28000 | 81657..81806 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DVJ72_RS28005 | 82090..82338 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-65 / catA2 / blaKPC-12 | - | 1..82649 | 82649 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T119658 WP_001312851.1 NZ_CP036366:81657-81806 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T119658 NZ_CP036366:81657-81806 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT119658 NZ_CP036366:c81612-81553 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|