Detailed information of TA system TA119530

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 91228..91481
• Replicon: plasmid pKPC2_020098
• Accession: NZ_CP036306
• Organism: Klebsiella pneumoniae strain WCHKP020098

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: C6M05_RS28080
• Protein ID: WP_001312851.1
• Coordinates: 91228..91377 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	91422..91481 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C6M05_RS28035	86587..87002	-	416	Protein_114	IS1 family transposase	-
C6M05_RS28040	87251..87652	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
C6M05_RS28045	87585..87842	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
C6M05_RS28050	87935..88588	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
C6M05_RS28060	89527..90384	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
C6M05_RS28065	90377..90451	-	75	WP_001375168.1	RepA leader peptide Tap	-
C6M05_RS28075	90696..90944	-	249	WP_000083837.1	replication regulatory protein RepA	-
C6M05_RS28080	91228..91377	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	91422..91481	+	60	NuclAT_1	-	Antitoxin
-	91422..91481	+	60	NuclAT_1	-	Antitoxin
-	91422..91481	+	60	NuclAT_1	-	Antitoxin
-	91422..91481	+	60	NuclAT_1	-	Antitoxin
C6M05_RS28090	91682..91912	-	231	WP_001736714.1	hypothetical protein	-
C6M05_RS28095	92076..92675	-	600	WP_032083981.1	hypothetical protein	-
C6M05_RS28100	93061..93261	-	201	WP_015059022.1	hypothetical protein	-
C6M05_RS28105	93393..93953	-	561	WP_000139328.1	fertility inhibition protein FinO	-
C6M05_RS28110	94008..94754	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
C6M05_RS28115	94774..94935	-	162	Protein_127	DNA helicase	-
C6M05_RS28120	94999..95703	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
C6M05_RS28125	95756..95821	+	66	Protein_129	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65	-	1..149519	149519

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T119530 WP_001312851.1 NZ_CP036306:c91377-91228 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T119530 NZ_CP036306:c91377-91228 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT119530 NZ_CP036306:91422-91481 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin