Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 153628..153881 | Replicon | plasmid pKPC2_015093 |
Accession | NZ_CP036301 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | CLQ99_RS28635 | Protein ID | WP_001312851.1 |
Coordinates | 153732..153881 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 153628..153687 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CLQ99_RS28590 | 149288..149353 | - | 66 | Protein_188 | helix-turn-helix domain-containing protein | - |
CLQ99_RS28595 | 149406..150110 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
CLQ99_RS28600 | 150174..150335 | + | 162 | Protein_190 | DNA helicase | - |
CLQ99_RS28605 | 150355..151101 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
CLQ99_RS28610 | 151156..151716 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
CLQ99_RS28615 | 151848..152048 | + | 201 | WP_015059022.1 | hypothetical protein | - |
CLQ99_RS28620 | 152434..153033 | + | 600 | WP_032083981.1 | hypothetical protein | - |
CLQ99_RS28625 | 153197..153427 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 153628..153687 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 153628..153687 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 153628..153687 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 153628..153687 | - | 60 | NuclAT_1 | - | Antitoxin |
CLQ99_RS28635 | 153732..153881 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CLQ99_RS28640 | 154165..154413 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..154724 | 154724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T119500 WP_001312851.1 NZ_CP036301:153732-153881 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T119500 NZ_CP036301:153732-153881 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT119500 NZ_CP036301:c153687-153628 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|