Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 40628..40898 | Replicon | plasmid pKPC2_015093 |
Accession | NZ_CP036301 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CLQ99_RS31200 | Protein ID | WP_001312861.1 |
Coordinates | 40740..40898 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 40628..40691 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CLQ99_RS27795 | 36339..36866 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
CLQ99_RS27800 | 36924..37157 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
CLQ99_RS27805 | 37218..39241 | + | 2024 | Protein_49 | ParB/RepB/Spo0J family partition protein | - |
CLQ99_RS27810 | 39310..39744 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
CLQ99_RS27815 | 39741..40460 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 40472..40696 | + | 225 | NuclAT_0 | - | - |
- | 40472..40696 | + | 225 | NuclAT_0 | - | - |
- | 40472..40696 | + | 225 | NuclAT_0 | - | - |
- | 40472..40696 | + | 225 | NuclAT_0 | - | - |
- | 40628..40691 | - | 64 | - | - | Antitoxin |
CLQ99_RS31200 | 40740..40898 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CLQ99_RS31550 | 41136..41513 | - | 378 | Protein_53 | hypothetical protein | - |
CLQ99_RS27840 | 41813..42109 | + | 297 | WP_001272251.1 | hypothetical protein | - |
CLQ99_RS27845 | 42220..43041 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
CLQ99_RS27850 | 43338..43985 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
CLQ99_RS27855 | 44262..44645 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
CLQ99_RS27860 | 44836..45522 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
CLQ99_RS27865 | 45616..45843 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..154724 | 154724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T119495 WP_001312861.1 NZ_CP036301:40740-40898 [Klebsiella pneumoniae subsp. pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T119495 NZ_CP036301:40740-40898 [Klebsiella pneumoniae subsp. pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT119495 NZ_CP036301:c40691-40628 [Klebsiella pneumoniae subsp. pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|