Detailed information of TA system TA119396

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1417860..1418081
• Replicon: chromosome
• Accession: NZ_CP036245
• Organism: Escherichia coli strain S65EC

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: S65EC_RS08125
• Protein ID: WP_001531632.1
• Coordinates: 1417860..1417967 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1418015..1418081 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
S65EC_RS08100	1413704..1414786	+	1083	WP_000804726.1	peptide chain release factor 1	-
S65EC_RS08105	1414786..1415619	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
S65EC_RS08110	1415616..1416008	+	393	WP_000200375.1	invasion regulator SirB2	-
S65EC_RS08115	1416012..1416821	+	810	WP_001257044.1	invasion regulator SirB1	-
S65EC_RS08120	1416857..1417711	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
S65EC_RS08125	1417860..1417967	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1418015..1418081	+	67	NuclAT_10	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_10	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_10	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_10	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_5	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_5	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_5	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_5	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_6	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_6	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_6	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_6	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_7	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_7	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_7	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_7	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_8	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_8	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_8	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_8	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_9	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_9	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_9	-	Antitoxin
-	1418015..1418081	+	67	NuclAT_9	-	Antitoxin
-	1418017..1418080	+	64	NuclAT_12	-	-
-	1418017..1418080	+	64	NuclAT_12	-	-
-	1418017..1418080	+	64	NuclAT_12	-	-
-	1418017..1418080	+	64	NuclAT_12	-	-
-	1418017..1418080	+	64	NuclAT_13	-	-
-	1418017..1418080	+	64	NuclAT_13	-	-
-	1418017..1418080	+	64	NuclAT_13	-	-
-	1418017..1418080	+	64	NuclAT_13	-	-
-	1418017..1418080	+	64	NuclAT_14	-	-
-	1418017..1418080	+	64	NuclAT_14	-	-
-	1418017..1418080	+	64	NuclAT_14	-	-
-	1418017..1418080	+	64	NuclAT_14	-	-
-	1418017..1418080	+	64	NuclAT_15	-	-
-	1418017..1418080	+	64	NuclAT_15	-	-
-	1418017..1418080	+	64	NuclAT_15	-	-
-	1418017..1418080	+	64	NuclAT_15	-	-
-	1418017..1418080	+	64	NuclAT_16	-	-
-	1418017..1418080	+	64	NuclAT_16	-	-
-	1418017..1418080	+	64	NuclAT_16	-	-
-	1418017..1418080	+	64	NuclAT_16	-	-
-	1418017..1418080	+	64	NuclAT_17	-	-
-	1418017..1418080	+	64	NuclAT_17	-	-
-	1418017..1418080	+	64	NuclAT_17	-	-
-	1418017..1418080	+	64	NuclAT_17	-	-
-	1418017..1418082	+	66	NuclAT_18	-	-
-	1418017..1418082	+	66	NuclAT_18	-	-
-	1418017..1418082	+	66	NuclAT_18	-	-
-	1418017..1418082	+	66	NuclAT_18	-	-
-	1418017..1418082	+	66	NuclAT_19	-	-
-	1418017..1418082	+	66	NuclAT_19	-	-
-	1418017..1418082	+	66	NuclAT_19	-	-
-	1418017..1418082	+	66	NuclAT_19	-	-
-	1418017..1418082	+	66	NuclAT_20	-	-
-	1418017..1418082	+	66	NuclAT_20	-	-
-	1418017..1418082	+	66	NuclAT_20	-	-
-	1418017..1418082	+	66	NuclAT_20	-	-
-	1418017..1418082	+	66	NuclAT_21	-	-
-	1418017..1418082	+	66	NuclAT_21	-	-
-	1418017..1418082	+	66	NuclAT_21	-	-
-	1418017..1418082	+	66	NuclAT_21	-	-
-	1418017..1418082	+	66	NuclAT_22	-	-
-	1418017..1418082	+	66	NuclAT_22	-	-
-	1418017..1418082	+	66	NuclAT_22	-	-
-	1418017..1418082	+	66	NuclAT_22	-	-
-	1418017..1418082	+	66	NuclAT_23	-	-
-	1418017..1418082	+	66	NuclAT_23	-	-
-	1418017..1418082	+	66	NuclAT_23	-	-
-	1418017..1418082	+	66	NuclAT_23	-	-
S65EC_RS08130	1418372..1419472	-	1101	WP_130647902.1	sodium-potassium/proton antiporter ChaA	-
S65EC_RS08135	1419742..1419981	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
S65EC_RS08140	1420130..1420825	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
S65EC_RS08145	1420869..1421222	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
S65EC_RS08150	1421407..1422801	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T119396 WP_001531632.1 NZ_CP036245:c1417967-1417860 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T119396 NZ_CP036245:c1417967-1417860 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT119396 NZ_CP036245:1418015-1418081 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin