Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1417860..1418081 | Replicon | chromosome |
Accession | NZ_CP036245 | ||
Organism | Escherichia coli strain S65EC |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A1U9U3P9 |
Locus tag | S65EC_RS08125 | Protein ID | WP_001531632.1 |
Coordinates | 1417860..1417967 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1418015..1418081 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
S65EC_RS08100 | 1413704..1414786 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
S65EC_RS08105 | 1414786..1415619 | + | 834 | WP_000456450.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
S65EC_RS08110 | 1415616..1416008 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
S65EC_RS08115 | 1416012..1416821 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
S65EC_RS08120 | 1416857..1417711 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
S65EC_RS08125 | 1417860..1417967 | - | 108 | WP_001531632.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1418015..1418081 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_10 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_5 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_6 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_7 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_8 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 1418015..1418081 | + | 67 | NuclAT_9 | - | Antitoxin |
- | 1418017..1418080 | + | 64 | NuclAT_12 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_12 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_12 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_12 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_13 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_13 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_13 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_13 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_14 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_14 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_14 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_14 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_15 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_15 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_15 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_15 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_16 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_16 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_16 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_16 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_17 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_17 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_17 | - | - |
- | 1418017..1418080 | + | 64 | NuclAT_17 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_18 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_18 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_18 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_18 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_19 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_19 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_19 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_19 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_20 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_20 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_20 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_20 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_21 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_21 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_21 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_21 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_22 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_22 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_22 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_22 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_23 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_23 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_23 | - | - |
- | 1418017..1418082 | + | 66 | NuclAT_23 | - | - |
S65EC_RS08130 | 1418372..1419472 | - | 1101 | WP_130647902.1 | sodium-potassium/proton antiporter ChaA | - |
S65EC_RS08135 | 1419742..1419981 | + | 240 | WP_000120702.1 | putative cation transport regulator ChaB | - |
S65EC_RS08140 | 1420130..1420825 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
S65EC_RS08145 | 1420869..1421222 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
S65EC_RS08150 | 1421407..1422801 | + | 1395 | WP_000086187.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4040.89 Da Isoelectric Point: 12.5163
>T119396 WP_001531632.1 NZ_CP036245:c1417967-1417860 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T119396 NZ_CP036245:c1417967-1417860 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT119396 NZ_CP036245:1418015-1418081 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|