Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 48464..48733 | Replicon | plasmid pS65EC |
Accession | NZ_CP036244 | ||
Organism | Escherichia coli strain S65EC |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | S65EC_RS00340 | Protein ID | WP_001312861.1 |
Coordinates | 48575..48733 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 48464..48529 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
S65EC_RS26965 | 43751..44086 | + | 336 | WP_014106969.1 | hypothetical protein | - |
S65EC_RS26970 | 43999..44205 | + | 207 | WP_000275853.1 | hypothetical protein | - |
S65EC_RS00315 | 44231..44770 | + | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
S65EC_RS00320 | 44833..45066 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
S65EC_RS00325 | 45132..47090 | + | 1959 | WP_086732397.1 | ParB/RepB/Spo0J family partition protein | - |
S65EC_RS00330 | 47145..47579 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
S65EC_RS00335 | 47576..48295 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
S65EC_RS26810 | 48307..48495 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 48307..48531 | + | 225 | NuclAT_0 | - | - |
- | 48307..48531 | + | 225 | NuclAT_0 | - | - |
- | 48307..48531 | + | 225 | NuclAT_0 | - | - |
- | 48307..48531 | + | 225 | NuclAT_0 | - | - |
- | 48464..48529 | + | 66 | - | - | Antitoxin |
S65EC_RS00340 | 48575..48733 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
S65EC_RS00360 | 49655..49942 | + | 288 | WP_000107535.1 | hypothetical protein | - |
S65EC_RS00365 | 50062..50883 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
S65EC_RS00370 | 51180..51782 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
S65EC_RS00375 | 52113..52496 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
S65EC_RS00380 | 52630..53307 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
S65EC_RS00385 | 53395..53622 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..146792 | 146792 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T119382 WP_001312861.1 NZ_CP036244:48575-48733 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T119382 NZ_CP036244:48575-48733 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT119382 NZ_CP036244:48464-48529 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|