Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69009..69279 | Replicon | plasmid p1_025970 |
| Accession | NZ_CP036180 | ||
| Organism | Escherichia coli strain WCHEC025970 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | EYD11_RS25390 | Protein ID | WP_001312861.1 |
| Coordinates | 69121..69279 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 69009..69072 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EYD11_RS25365 | 64720..65247 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| EYD11_RS25370 | 65305..65538 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| EYD11_RS25375 | 65599..67622 | + | 2024 | Protein_81 | ParB/RepB/Spo0J family partition protein | - |
| EYD11_RS25380 | 67691..68125 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| EYD11_RS25385 | 68122..68841 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 68853..69077 | + | 225 | NuclAT_0 | - | - |
| - | 68853..69077 | + | 225 | NuclAT_0 | - | - |
| - | 68853..69077 | + | 225 | NuclAT_0 | - | - |
| - | 68853..69077 | + | 225 | NuclAT_0 | - | - |
| EYD11_RS26680 | 68862..69041 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 69009..69072 | - | 64 | - | - | Antitoxin |
| EYD11_RS25390 | 69121..69279 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| EYD11_RS26835 | 69517..69894 | - | 378 | Protein_86 | hypothetical protein | - |
| EYD11_RS25410 | 70194..70490 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| EYD11_RS25415 | 70601..71422 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| EYD11_RS25420 | 71719..72366 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| EYD11_RS25425 | 72643..73026 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| EYD11_RS25430 | 73217..73903 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| EYD11_RS25435 | 73997..74224 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB | - | 1..109593 | 109593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T119281 WP_001312861.1 NZ_CP036180:69121-69279 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T119281 NZ_CP036180:69121-69279 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT119281 NZ_CP036180:c69072-69009 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|