Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41562..41789 | Replicon | plasmid pE2528C1_95 |
Accession | NZ_CP035872 | ||
Organism | Escherichia coli strain E2528-C1 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | EW999_RS24830 | Protein ID | WP_064727294.1 |
Coordinates | 41562..41684 (-) | Length | 41 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 41733..41789 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW999_RS24805 (37173) | 37173..37247 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
EW999_RS24810 (37472) | 37472..37732 | - | 261 | WP_000083817.1 | replication regulatory protein RepA | - |
EW999_RS24815 (38256) | 38256..39620 | + | 1365 | Protein_42 | IS21-like element ISEc12 family transposase | - |
EW999_RS24825 (40931) | 40931..41491 | + | 561 | Protein_44 | IS21-like element ISEc12 family helper ATPase IstB | - |
EW999_RS24830 (41562) | 41562..41684 | - | 123 | WP_064727294.1 | Hok/Gef family protein | Toxin |
- (41733) | 41733..41789 | + | 57 | NuclAT_1 | - | Antitoxin |
- (41733) | 41733..41789 | + | 57 | NuclAT_1 | - | Antitoxin |
- (41733) | 41733..41789 | + | 57 | NuclAT_1 | - | Antitoxin |
- (41733) | 41733..41789 | + | 57 | NuclAT_1 | - | Antitoxin |
EW999_RS24835 (42033) | 42033..42215 | + | 183 | WP_001393357.1 | hypothetical protein | - |
EW999_RS24840 (42439) | 42439..43170 | - | 732 | WP_001734655.1 | type-F conjugative transfer system pilin acetylase TraX | - |
EW999_RS24845 (43167) | 43167..43733 | - | 567 | WP_024169751.1 | DUF2726 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | eltB / eltA / cssA | 1..95521 | 95521 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4495.51 Da Isoelectric Point: 8.1317
>T118930 WP_064727294.1 NZ_CP035872:c41684-41562 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNCVLP
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNCVLP
Download Length: 123 bp
>T118930 NZ_CP035872:c41684-41562 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGAGGAAATTGCGTATTACCGTGA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGAGGAAATTGCGTATTACCGTGA
Antitoxin
Download Length: 57 bp
>AT118930 NZ_CP035872:41733-41789 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|