Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 155..47266 Replicon plasmid pTD225C4_47
Accession NZ_CP035864
Organism Escherichia coli strain TD225-C4

Toxin (Protein)


Gene name higB Uniprot ID A0A4Q6IVD3
Locus tag EXA00_RS25800 Protein ID WP_004105250.1
Coordinates 47266..155 (+) Length -15703.333333333 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A1V3UZT0
Locus tag EXA00_RS25805 Protein ID WP_001259436.1
Coordinates 155..454 (+) Length 100 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EXA00_RS25805 155..454 + 300 WP_001259436.1 XRE family transcriptional regulator Antitoxin
EXA00_RS25810 618..998 + 381 WP_032154029.1 hypothetical protein -
EXA00_RS25815 1062..1334 + 273 WP_000148347.1 helix-turn-helix domain-containing protein -
EXA00_RS25820 1944..2132 + 189 WP_004105254.1 hypothetical protein -
EXA00_RS26430 2143..2769 - 627 WP_231367439.1 Rha family transcriptional regulator -
EXA00_RS26435 2938..3411 - 474 Protein_6 ORF6N domain-containing protein -
EXA00_RS25830 3408..3599 - 192 WP_000183352.1 hypothetical protein -
EXA00_RS25835 4729..4977 - 249 WP_000730007.1 hypothetical protein -
EXA00_RS25840 5021..5674 - 654 WP_000156167.1 ParA family protein -
EXA00_RS25845 5825..6199 - 375 WP_097325764.1 hypothetical protein -
EXA00_RS25850 6292..6954 - 663 WP_000839974.1 helix-turn-helix domain-containing protein -
EXA00_RS25855 7127..7621 + 495 WP_000143878.1 hypothetical protein -
EXA00_RS25860 7618..8133 + 516 WP_080855625.1 hypothetical protein -
EXA00_RS25865 8130..8363 + 234 WP_000017467.1 hypothetical protein -
EXA00_RS25870 8363..8767 + 405 WP_001014471.1 Ref family recombination enhancement nuclease -
EXA00_RS25875 8764..9096 + 333 WP_001270825.1 DUF1064 domain-containing protein -
EXA00_RS25880 9100..9477 + 378 WP_001250512.1 hypothetical protein -
EXA00_RS25885 9648..10715 + 1068 WP_216334380.1 DUF3560 domain-containing protein -
EXA00_RS25890 10793..11074 + 282 WP_000823235.1 hypothetical protein -
EXA00_RS26440 11071..11262 + 192 Protein_20 hypothetical protein -
EXA00_RS25900 11630..12148 + 519 WP_244448443.1 ead/Ea22-like family protein -
EXA00_RS25905 12150..12359 + 210 WP_023156633.1 hypothetical protein -
EXA00_RS25910 12356..12496 + 141 Protein_23 Eaa protein -
EXA00_RS25915 13042..13437 + 396 WP_001271967.1 phage holin family protein -
EXA00_RS25920 13424..13720 + 297 WP_000254764.1 phage holin family protein -
EXA00_RS25925 13704..14249 + 546 WP_024180651.1 putative peptidoglycan-binding domain-containing protein -
EXA00_RS25930 14246..14524 + 279 WP_000147213.1 hypothetical protein -
EXA00_RS25940 15202..15789 + 588 WP_000387271.1 MT-A70 family methyltransferase -
EXA00_RS25945 15901..16170 + 270 WP_000867916.1 hypothetical protein -
EXA00_RS25950 16170..16367 + 198 WP_001222808.1 hypothetical protein -
EXA00_RS25955 16442..16741 + 300 WP_044326186.1 hypothetical protein -
EXA00_RS25960 16928..17080 + 153 WP_001013684.1 hypothetical protein -
EXA00_RS25965 17128..17538 + 411 WP_000412080.1 hypothetical protein -
EXA00_RS25970 17773..18396 + 624 WP_087890066.1 ParB/Srx family N-terminal domain-containing protein -
EXA00_RS25975 18396..19769 + 1374 WP_216334382.1 ParB N-terminal domain-containing protein -
EXA00_RS25980 19786..20505 + 720 WP_000775053.1 hypothetical protein -
EXA00_RS25985 21063..21653 + 591 WP_001185429.1 ParB/Srx family N-terminal domain-containing protein -
EXA00_RS25990 21653..22204 + 552 WP_001019009.1 hypothetical protein -
EXA00_RS25995 22210..24066 + 1857 WP_042095056.1 phage terminase large subunit family protein -
EXA00_RS26000 24078..24317 + 240 WP_001058287.1 DUF6148 family protein -
EXA00_RS26005 24314..25888 + 1575 WP_001022885.1 phage portal protein -
EXA00_RS26010 25878..26945 + 1068 WP_097325768.1 Clp protease ClpP -
EXA00_RS26015 26955..27338 + 384 WP_001209256.1 hypothetical protein -
EXA00_RS26020 27359..28402 + 1044 WP_001132883.1 major capsid protein -
EXA00_RS26025 28403..28795 + 393 WP_000113177.1 hypothetical protein -
EXA00_RS26030 28795..29139 + 345 WP_001083981.1 hypothetical protein -
EXA00_RS26035 29136..29621 + 486 WP_042095054.1 hypothetical protein -
EXA00_RS26040 29622..29912 + 291 WP_001284547.1 hypothetical protein -
EXA00_RS26045 29912..31375 + 1464 WP_047608080.1 phage tail protein -
EXA00_RS26050 31392..31913 + 522 WP_000070729.1 phage major tail tube protein -
EXA00_RS26055 31923..32204 + 282 WP_000450805.1 phage tail assembly protein -
EXA00_RS26060 32359..35151 + 2793 WP_216334374.1 phage tail tape measure protein -
EXA00_RS26065 35352..36353 + 1002 WP_000944895.1 contractile injection system protein, VgrG/Pvc8 family -
EXA00_RS26070 36356..36976 + 621 WP_000998643.1 phage baseplate assembly protein V -
EXA00_RS26075 36973..37440 + 468 WP_000635200.1 phage tail protein -
EXA00_RS26080 37437..37757 + 321 WP_016265986.1 hypothetical protein -
EXA00_RS26085 37754..38878 + 1125 WP_000174657.1 baseplate J/gp47 family protein -
EXA00_RS26090 38871..39452 + 582 WP_000763348.1 phage tail protein I -
EXA00_RS26095 39483..41912 + 2430 WP_216334376.1 tail fiber protein -
EXA00_RS26100 41915..42448 + 534 WP_080855689.1 tail fiber assembly protein -
EXA00_RS26105 42477..43004 - 528 WP_096930109.1 tail fiber assembly protein -
EXA00_RS26110 43008..43970 - 963 WP_096930111.1 phage tail protein -
EXA00_RS26115 44085..44639 + 555 WP_047608106.1 recombinase family protein -
EXA00_RS26120 44967..45803 + 837 WP_001139597.1 plasmid replication initiator RepA -
EXA00_RS26125 46447..46734 + 288 WP_216334378.1 hypothetical protein -
EXA00_RS26130 46758..47021 + 264 WP_000424604.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..47458 47458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

(32-80)


Sequences


Toxin        


Download         Length: -15703.333333333 a.a.        Molecular weight: 7046.98 Da        Isoelectric Point: 9.2886

>T118877 WP_004105250.1 NZ_CP035864:47266-155 [Escherichia coli]

Download         Length: -47110 bp

>T118877 NZ_CP035864:47266-155 [Escherichia coli]

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11074.92 Da        Isoelectric Point: 5.2090

>AT118877 WP_001259436.1 NZ_CP035864:155-454 [Escherichia coli]
MRTLDEVIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRIAFNI

Download         Length: 300 bp

>AT118877 NZ_CP035864:155-454 [Escherichia coli]
ATGAGAACATTAGATGAGGTGATTGCCAGCCGTTCACCGGAAAGCCAGGCGCGAATTAAAGAAATGGCAGATGAGATGAT
TCTTGAGGTCGGCTTGCAGATGATGCGTGAAGAACTCCAGTTATCACAAAAGCAGGTTGCTGAGGCGATGGGTATAAGCC
AGCCAGCAGTAACAAAGCTGGAGCAGCGCGGAAATGATTTAAAGCTGGCGACATTAAAGCGTTACGTTGAAGCTATGGGA
GGCAAATTAAGCCTGGATGTTGAGCTTCCCACAGGAAAACGAATAGCGTTTAACATCTGA

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A4Q6IVD3


Antitoxin

Source ID Structure
AlphaFold DB A0A1V3UZT0

References