Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30269..30533 | Replicon | plasmid pWS1933D_74 |
| Accession | NZ_CP035840 | ||
| Organism | Escherichia coli strain WS1933D | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | EXA03_RS26235 | Protein ID | WP_001303307.1 |
| Coordinates | 30269..30421 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 30471..30533 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EXA03_RS26205 (25525) | 25525..27693 | + | 2169 | WP_000698356.1 | DotA/TraY family protein | - |
| EXA03_RS26210 (27764) | 27764..28426 | + | 663 | WP_000644795.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| EXA03_RS26215 (28498) | 28498..28707 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| EXA03_RS26220 (29109) | 29109..29285 | + | 177 | WP_001054898.1 | hypothetical protein | - |
| EXA03_RS26225 (29350) | 29350..29646 | - | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
| EXA03_RS26230 (29946) | 29946..30197 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| EXA03_RS26235 (30269) | 30269..30421 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (30471) | 30471..30533 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (30471) | 30471..30533 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (30471) | 30471..30533 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (30471) | 30471..30533 | + | 63 | NuclAT_0 | - | Antitoxin |
| EXA03_RS26240 (30742) | 30742..31827 | + | 1086 | WP_000080544.1 | hypothetical protein | - |
| - (31897) | 31897..31955 | + | 59 | NuclAT_1 | - | - |
| - (31897) | 31897..31955 | + | 59 | NuclAT_1 | - | - |
| - (31897) | 31897..31955 | + | 59 | NuclAT_1 | - | - |
| - (31897) | 31897..31955 | + | 59 | NuclAT_1 | - | - |
| EXA03_RS26245 (32135) | 32135..33343 | + | 1209 | WP_001295719.1 | IncI1-type conjugal transfer protein TrbA | - |
| EXA03_RS26250 (33362) | 33362..34432 | + | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..74294 | 74294 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T118723 WP_001303307.1 NZ_CP035840:c30421-30269 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T118723 NZ_CP035840:c30421-30269 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT118723 NZ_CP035840:30471-30533 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|