Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3102176..3102396 Replicon chromosome
Accession NZ_CP035817
Organism Escherichia coli strain E7476

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag EXA08_RS15280 Protein ID WP_000170965.1
Coordinates 3102289..3102396 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3102176..3102242 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EXA08_RS15255 3097455..3098849 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
EXA08_RS15260 3099034..3099387 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
EXA08_RS15265 3099431..3100126 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
EXA08_RS15270 3100284..3100514 - 231 WP_001146442.1 putative cation transport regulator ChaB -
EXA08_RS15275 3100784..3101884 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 3102176..3102242 - 67 - - Antitoxin
EXA08_RS15280 3102289..3102396 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3102709..3102772 - 64 NuclAT_32 - -
- 3102709..3102772 - 64 NuclAT_32 - -
- 3102709..3102772 - 64 NuclAT_32 - -
- 3102709..3102772 - 64 NuclAT_32 - -
- 3102709..3102772 - 64 NuclAT_35 - -
- 3102709..3102772 - 64 NuclAT_35 - -
- 3102709..3102772 - 64 NuclAT_35 - -
- 3102709..3102772 - 64 NuclAT_35 - -
- 3102709..3102772 - 64 NuclAT_38 - -
- 3102709..3102772 - 64 NuclAT_38 - -
- 3102709..3102772 - 64 NuclAT_38 - -
- 3102709..3102772 - 64 NuclAT_38 - -
- 3102709..3102772 - 64 NuclAT_41 - -
- 3102709..3102772 - 64 NuclAT_41 - -
- 3102709..3102772 - 64 NuclAT_41 - -
- 3102709..3102772 - 64 NuclAT_41 - -
- 3102709..3102772 - 64 NuclAT_44 - -
- 3102709..3102772 - 64 NuclAT_44 - -
- 3102709..3102772 - 64 NuclAT_44 - -
- 3102709..3102772 - 64 NuclAT_44 - -
- 3102709..3102772 - 64 NuclAT_47 - -
- 3102709..3102772 - 64 NuclAT_47 - -
- 3102709..3102772 - 64 NuclAT_47 - -
- 3102709..3102772 - 64 NuclAT_47 - -
- 3102710..3102772 - 63 NuclAT_49 - -
- 3102710..3102772 - 63 NuclAT_49 - -
- 3102710..3102772 - 63 NuclAT_49 - -
- 3102710..3102772 - 63 NuclAT_49 - -
- 3102710..3102772 - 63 NuclAT_52 - -
- 3102710..3102772 - 63 NuclAT_52 - -
- 3102710..3102772 - 63 NuclAT_52 - -
- 3102710..3102772 - 63 NuclAT_52 - -
- 3102710..3102772 - 63 NuclAT_55 - -
- 3102710..3102772 - 63 NuclAT_55 - -
- 3102710..3102772 - 63 NuclAT_55 - -
- 3102710..3102772 - 63 NuclAT_55 - -
- 3102710..3102772 - 63 NuclAT_58 - -
- 3102710..3102772 - 63 NuclAT_58 - -
- 3102710..3102772 - 63 NuclAT_58 - -
- 3102710..3102772 - 63 NuclAT_58 - -
- 3102711..3102772 - 62 NuclAT_14 - -
- 3102711..3102772 - 62 NuclAT_14 - -
- 3102711..3102772 - 62 NuclAT_14 - -
- 3102711..3102772 - 62 NuclAT_14 - -
- 3102711..3102772 - 62 NuclAT_17 - -
- 3102711..3102772 - 62 NuclAT_17 - -
- 3102711..3102772 - 62 NuclAT_17 - -
- 3102711..3102772 - 62 NuclAT_17 - -
- 3102711..3102772 - 62 NuclAT_20 - -
- 3102711..3102772 - 62 NuclAT_20 - -
- 3102711..3102772 - 62 NuclAT_20 - -
- 3102711..3102772 - 62 NuclAT_20 - -
- 3102711..3102772 - 62 NuclAT_23 - -
- 3102711..3102772 - 62 NuclAT_23 - -
- 3102711..3102772 - 62 NuclAT_23 - -
- 3102711..3102772 - 62 NuclAT_23 - -
- 3102711..3102772 - 62 NuclAT_26 - -
- 3102711..3102772 - 62 NuclAT_26 - -
- 3102711..3102772 - 62 NuclAT_26 - -
- 3102711..3102772 - 62 NuclAT_26 - -
- 3102711..3102772 - 62 NuclAT_29 - -
- 3102711..3102772 - 62 NuclAT_29 - -
- 3102711..3102772 - 62 NuclAT_29 - -
- 3102711..3102772 - 62 NuclAT_29 - -
EXA08_RS15285 3102825..3102932 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3103245..3103310 - 66 NuclAT_31 - -
- 3103245..3103310 - 66 NuclAT_31 - -
- 3103245..3103310 - 66 NuclAT_31 - -
- 3103245..3103310 - 66 NuclAT_31 - -
- 3103245..3103310 - 66 NuclAT_34 - -
- 3103245..3103310 - 66 NuclAT_34 - -
- 3103245..3103310 - 66 NuclAT_34 - -
- 3103245..3103310 - 66 NuclAT_34 - -
- 3103245..3103310 - 66 NuclAT_37 - -
- 3103245..3103310 - 66 NuclAT_37 - -
- 3103245..3103310 - 66 NuclAT_37 - -
- 3103245..3103310 - 66 NuclAT_37 - -
- 3103245..3103310 - 66 NuclAT_40 - -
- 3103245..3103310 - 66 NuclAT_40 - -
- 3103245..3103310 - 66 NuclAT_40 - -
- 3103245..3103310 - 66 NuclAT_40 - -
- 3103245..3103310 - 66 NuclAT_43 - -
- 3103245..3103310 - 66 NuclAT_43 - -
- 3103245..3103310 - 66 NuclAT_43 - -
- 3103245..3103310 - 66 NuclAT_43 - -
- 3103245..3103310 - 66 NuclAT_46 - -
- 3103245..3103310 - 66 NuclAT_46 - -
- 3103245..3103310 - 66 NuclAT_46 - -
- 3103245..3103310 - 66 NuclAT_46 - -
- 3103246..3103312 - 67 NuclAT_48 - -
- 3103246..3103312 - 67 NuclAT_48 - -
- 3103246..3103312 - 67 NuclAT_48 - -
- 3103246..3103312 - 67 NuclAT_48 - -
- 3103246..3103312 - 67 NuclAT_51 - -
- 3103246..3103312 - 67 NuclAT_51 - -
- 3103246..3103312 - 67 NuclAT_51 - -
- 3103246..3103312 - 67 NuclAT_51 - -
- 3103246..3103312 - 67 NuclAT_54 - -
- 3103246..3103312 - 67 NuclAT_54 - -
- 3103246..3103312 - 67 NuclAT_54 - -
- 3103246..3103312 - 67 NuclAT_54 - -
- 3103246..3103312 - 67 NuclAT_57 - -
- 3103246..3103312 - 67 NuclAT_57 - -
- 3103246..3103312 - 67 NuclAT_57 - -
- 3103246..3103312 - 67 NuclAT_57 - -
- 3103247..3103310 - 64 NuclAT_13 - -
- 3103247..3103310 - 64 NuclAT_13 - -
- 3103247..3103310 - 64 NuclAT_13 - -
- 3103247..3103310 - 64 NuclAT_13 - -
- 3103247..3103310 - 64 NuclAT_16 - -
- 3103247..3103310 - 64 NuclAT_16 - -
- 3103247..3103310 - 64 NuclAT_16 - -
- 3103247..3103310 - 64 NuclAT_16 - -
- 3103247..3103310 - 64 NuclAT_19 - -
- 3103247..3103310 - 64 NuclAT_19 - -
- 3103247..3103310 - 64 NuclAT_19 - -
- 3103247..3103310 - 64 NuclAT_19 - -
- 3103247..3103310 - 64 NuclAT_22 - -
- 3103247..3103310 - 64 NuclAT_22 - -
- 3103247..3103310 - 64 NuclAT_22 - -
- 3103247..3103310 - 64 NuclAT_22 - -
- 3103247..3103310 - 64 NuclAT_25 - -
- 3103247..3103310 - 64 NuclAT_25 - -
- 3103247..3103310 - 64 NuclAT_25 - -
- 3103247..3103310 - 64 NuclAT_25 - -
- 3103247..3103310 - 64 NuclAT_28 - -
- 3103247..3103310 - 64 NuclAT_28 - -
- 3103247..3103310 - 64 NuclAT_28 - -
- 3103247..3103310 - 64 NuclAT_28 - -
EXA08_RS15290 3103360..3103467 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
EXA08_RS15295 3103616..3104470 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EXA08_RS15300 3104506..3105315 - 810 WP_001257044.1 invasion regulator SirB1 -
EXA08_RS15305 3105319..3105711 - 393 WP_000200392.1 invasion regulator SirB2 -
EXA08_RS15310 3105708..3106541 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T118586 WP_000170965.1 NZ_CP035817:3102289-3102396 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T118586 NZ_CP035817:3102289-3102396 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT118586 NZ_CP035817:c3102242-3102176 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References