Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5591..5861 | Replicon | plasmid pE110019_66 |
| Accession | NZ_CP035752 | ||
| Organism | Escherichia coli E110019 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECE110019_RS25855 | Protein ID | WP_001312861.1 |
| Coordinates | 5703..5861 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 5591..5654 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECE110019_RS25830 | 1359..1898 | + | 540 | WP_000290791.1 | single-stranded DNA-binding protein | - |
| ECE110019_RS25835 | 1961..2194 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| ECE110019_RS25840 | 2260..4218 | + | 1959 | WP_000117175.1 | ParB/RepB/Spo0J family partition protein | - |
| ECE110019_RS25845 | 4273..4707 | + | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
| ECE110019_RS25850 | 4704..5423 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| - | 5435..5659 | + | 225 | NuclAT_0 | - | - |
| - | 5435..5659 | + | 225 | NuclAT_0 | - | - |
| - | 5435..5659 | + | 225 | NuclAT_0 | - | - |
| - | 5435..5659 | + | 225 | NuclAT_0 | - | - |
| - | 5591..5654 | - | 64 | - | - | Antitoxin |
| ECE110019_RS25855 | 5703..5861 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECE110019_RS25860 | 6215..6427 | - | 213 | WP_162817365.1 | hypothetical protein | - |
| ECE110019_RS25870 | 6783..7070 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| ECE110019_RS25875 | 7188..8009 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| ECE110019_RS25880 | 8306..8896 | - | 591 | WP_165899088.1 | transglycosylase SLT domain-containing protein | - |
| ECE110019_RS25885 | 9229..9612 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| ECE110019_RS25890 | 9799..10488 | + | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkJ / mrkI | 1..66171 | 66171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T118396 WP_001312861.1 NZ_CP035752:5703-5861 [Escherichia coli E110019]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T118396 NZ_CP035752:5703-5861 [Escherichia coli E110019]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT118396 NZ_CP035752:c5654-5591 [Escherichia coli E110019]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|