Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2554192..2554372 | Replicon | chromosome |
Accession | NZ_CP035671 | ||
Organism | Staphylococcus aureus strain VB31683 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EWG56_RS13240 | Protein ID | WP_001801861.1 |
Coordinates | 2554277..2554372 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2554192..2554249 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EWG56_RS13205 | 2549218..2550399 | + | 1182 | WP_000162901.1 | hypothetical protein | - |
EWG56_RS13210 | 2550714..2551013 | - | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
EWG56_RS13215 | 2551028..2552641 | - | 1614 | WP_000926708.1 | lipase | - |
EWG56_RS13220 | 2552686..2553126 | + | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
EWG56_RS13225 | 2553332..2553709 | + | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
EWG56_RS13230 | 2553903..2554075 | + | 173 | Protein_2450 | transposase | - |
EWG56_RS13235 | 2554053..2554154 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 2554192..2554249 | + | 58 | - | - | Antitoxin |
EWG56_RS13240 | 2554277..2554372 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
EWG56_RS13245 | 2554517..2554621 | + | 105 | WP_001670380.1 | transposase | - |
EWG56_RS13255 | 2555201..2555584 | + | 384 | WP_000070809.1 | hypothetical protein | - |
EWG56_RS13260 | 2555595..2555771 | + | 177 | WP_000375476.1 | hypothetical protein | - |
EWG56_RS13270 | 2556143..2556712 | + | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
EWG56_RS13275 | 2556909..2557481 | - | 573 | WP_000414208.1 | hypothetical protein | - |
EWG56_RS13280 | 2557582..2557923 | - | 342 | WP_000627535.1 | DUF3969 family protein | - |
EWG56_RS13285 | 2557964..2558590 | - | 627 | WP_000669029.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 2535766..2581519 | 45753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T118224 WP_001801861.1 NZ_CP035671:c2554372-2554277 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T118224 NZ_CP035671:c2554372-2554277 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT118224 NZ_CP035671:2554192-2554249 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|