Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1921093..1921277 | Replicon | chromosome |
Accession | NZ_CP035671 | ||
Organism | Staphylococcus aureus strain VB31683 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | EWG56_RS09565 | Protein ID | WP_000482647.1 |
Coordinates | 1921093..1921200 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1921217..1921277 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EWG56_RS09540 | 1916458..1916931 | + | 474 | WP_000456498.1 | GyrI-like domain-containing protein | - |
EWG56_RS09545 | 1917054..1918265 | - | 1212 | WP_001191976.1 | multidrug effflux MFS transporter | - |
EWG56_RS09550 | 1918444..1919103 | - | 660 | WP_000831298.1 | membrane protein | - |
EWG56_RS09555 | 1919163..1920305 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
EWG56_RS09560 | 1920573..1920959 | + | 387 | WP_000779356.1 | flippase GtxA | - |
EWG56_RS09565 | 1921093..1921200 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1921217..1921277 | - | 61 | - | - | Antitoxin |
EWG56_RS09570 | 1921904..1923667 | + | 1764 | WP_001064812.1 | ABC transporter ATP-binding protein/permease | - |
EWG56_RS09575 | 1923692..1925425 | + | 1734 | WP_000486501.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T118211 WP_000482647.1 NZ_CP035671:1921093-1921200 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T118211 NZ_CP035671:1921093-1921200 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT118211 NZ_CP035671:c1921277-1921217 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|