Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4456565..4456786 | Replicon | chromosome |
Accession | NZ_CP035545 | ||
Organism | Escherichia coli strain FSIS11705876 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | EB814_RS22460 | Protein ID | WP_001295224.1 |
Coordinates | 4456565..4456672 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4456721..4456786 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EB814_RS22435 | 4451818..4452570 | - | 753 | Protein_4377 | cellulose biosynthesis protein BcsQ | - |
EB814_RS22440 | 4452582..4452770 | - | 189 | WP_001063316.1 | YhjR family protein | - |
EB814_RS22445 | 4453043..4454614 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
EB814_RS22450 | 4454611..4454802 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
EB814_RS22455 | 4454799..4456478 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
EB814_RS22460 | 4456565..4456672 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4456721..4456786 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4456721..4456786 | + | 66 | NuclAT_21 | - | Antitoxin |
EB814_RS22465 | 4457148..4458419 | + | 1272 | WP_001301684.1 | amino acid permease | - |
EB814_RS22470 | 4458449..4459453 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
EB814_RS22475 | 4459450..4460433 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
EB814_RS22480 | 4460444..4461346 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T118143 WP_001295224.1 NZ_CP035545:c4456672-4456565 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T118143 NZ_CP035545:c4456672-4456565 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT118143 NZ_CP035545:4456721-4456786 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|