Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1179579..1179804 | Replicon | chromosome |
| Accession | NZ_CP035545 | ||
| Organism | Escherichia coli strain FSIS11705876 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | EB814_RS05435 | Protein ID | WP_000813263.1 |
| Coordinates | 1179649..1179804 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1179579..1179637 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB814_RS05400 | 1174640..1175386 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| EB814_RS05405 | 1175408..1176094 | + | 687 | WP_153983941.1 | DUF1627 domain-containing protein | - |
| EB814_RS05410 | 1176146..1177358 | + | 1213 | Protein_1058 | IS3 family transposase | - |
| EB814_RS05415 | 1177401..1177490 | + | 90 | Protein_1059 | DUF1627 domain-containing protein | - |
| EB814_RS05420 | 1177506..1177919 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| EB814_RS05425 | 1178271..1179044 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 1179579..1179637 | - | 59 | - | - | Antitoxin |
| EB814_RS05435 | 1179649..1179804 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| EB814_RS05440 | 1179972..1180250 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| EB814_RS05445 | 1180252..1181301 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| EB814_RS05450 | 1181314..1181685 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EB814_RS05455 | 1181675..1182046 | + | 372 | WP_000090264.1 | antitermination protein | - |
| EB814_RS05460 | 1182198..1183016 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| EB814_RS05465 | 1183303..1183499 | + | 197 | Protein_1068 | TrmB family transcriptional regulator | - |
| EB814_RS05470 | 1183637..1184350 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T118118 WP_000813263.1 NZ_CP035545:1179649-1179804 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T118118 NZ_CP035545:1179649-1179804 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT118118 NZ_CP035545:c1179637-1179579 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|