Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3397..3639 | Replicon | plasmid pU14A_A |
Accession | NZ_CP035517 | ||
Organism | Escherichia coli strain U14A |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | U14A_RS25245 | Protein ID | WP_001312861.1 |
Coordinates | 3397..3555 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 3599..3639 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
U14A_RS25215 | 349..951 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
U14A_RS25220 | 1248..2069 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
U14A_RS25225 | 2188..2475 | - | 288 | WP_000107535.1 | hypothetical protein | - |
U14A_RS27165 | 2500..2706 | - | 207 | WP_000275859.1 | hypothetical protein | - |
U14A_RS27170 | 2619..2954 | - | 336 | WP_013023876.1 | hypothetical protein | - |
U14A_RS25245 | 3397..3555 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 3599..3639 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 3599..3639 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 3599..3639 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 3599..3639 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 5083..5269 | - | 187 | NuclAT_0 | - | - |
- | 5083..5269 | - | 187 | NuclAT_0 | - | - |
- | 5083..5269 | - | 187 | NuclAT_0 | - | - |
- | 5083..5269 | - | 187 | NuclAT_0 | - | - |
U14A_RS25255 | 5281..6000 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
U14A_RS25260 | 5997..6431 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
U14A_RS25265 | 6486..8444 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B | senB | 1..149317 | 149317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T118053 WP_001312861.1 NZ_CP035517:c3555-3397 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T118053 NZ_CP035517:c3555-3397 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT118053 NZ_CP035517:c3639-3599 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|