Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 32221..32491 | Replicon | plasmid pU13A_B |
Accession | NZ_CP035479 | ||
Organism | Escherichia coli strain U13A |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | U13A_RS26480 | Protein ID | WP_001312861.1 |
Coordinates | 32333..32491 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 32221..32284 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
U13A_RS26455 | 27991..28530 | + | 540 | WP_001530505.1 | single-stranded DNA-binding protein | - |
U13A_RS26460 | 28592..28825 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
U13A_RS26465 | 28890..30848 | + | 1959 | WP_000117213.1 | ParB/RepB/Spo0J family partition protein | - |
U13A_RS26470 | 30903..31337 | + | 435 | WP_000845910.1 | conjugation system SOS inhibitor PsiB | - |
U13A_RS26475 | 31334..32053 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
U13A_RS27015 | 32065..32253 | - | 189 | WP_001336239.1 | hypothetical protein | - |
- | 32065..32289 | + | 225 | NuclAT_0 | - | - |
- | 32065..32289 | + | 225 | NuclAT_0 | - | - |
- | 32065..32289 | + | 225 | NuclAT_0 | - | - |
- | 32065..32289 | + | 225 | NuclAT_0 | - | - |
- | 32221..32284 | - | 64 | - | - | Antitoxin |
U13A_RS26480 | 32333..32491 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
U13A_RS26495 | 33418..33705 | + | 288 | WP_000107526.1 | hypothetical protein | - |
U13A_RS26500 | 33824..34645 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
U13A_RS26510 | 34940..35542 | - | 603 | WP_023908348.1 | transglycosylase SLT domain-containing protein | - |
U13A_RS26520 | 35865..36248 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
U13A_RS26525 | 36442..37113 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
U13A_RS26530 | 37250..37477 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..69518 | 69518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T117939 WP_001312861.1 NZ_CP035479:32333-32491 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T117939 NZ_CP035479:32333-32491 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT117939 NZ_CP035479:c32284-32221 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|