Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32222..32491 | Replicon | plasmid pU12A_C |
| Accession | NZ_CP035470 | ||
| Organism | Escherichia coli strain U12A | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | U12A_RS01890 | Protein ID | WP_001312861.1 |
| Coordinates | 32333..32491 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 32222..32287 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U12A_RS01865 | 27991..28530 | + | 540 | WP_001530505.1 | single-stranded DNA-binding protein | - |
| U12A_RS01870 | 28592..28825 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| U12A_RS01875 | 28890..30848 | + | 1959 | WP_000117213.1 | ParB/RepB/Spo0J family partition protein | - |
| U12A_RS01880 | 30903..31337 | + | 435 | WP_000845910.1 | conjugation system SOS inhibitor PsiB | - |
| U12A_RS01885 | 31334..32053 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| U12A_RS27490 | 32065..32253 | - | 189 | WP_001336239.1 | hypothetical protein | - |
| - | 32065..32289 | + | 225 | NuclAT_0 | - | - |
| - | 32065..32289 | + | 225 | NuclAT_0 | - | - |
| - | 32065..32289 | + | 225 | NuclAT_0 | - | - |
| - | 32065..32289 | + | 225 | NuclAT_0 | - | - |
| - | 32222..32287 | + | 66 | - | - | Antitoxin |
| U12A_RS01890 | 32333..32491 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| U12A_RS01905 | 33418..33705 | + | 288 | WP_000107526.1 | hypothetical protein | - |
| U12A_RS01910 | 33824..34645 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| U12A_RS01920 | 34940..35542 | - | 603 | WP_023908348.1 | transglycosylase SLT domain-containing protein | - |
| U12A_RS01930 | 35865..36248 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| U12A_RS01935 | 36442..37113 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| U12A_RS01940 | 37250..37477 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..69518 | 69518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T117865 WP_001312861.1 NZ_CP035470:32333-32491 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T117865 NZ_CP035470:32333-32491 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT117865 NZ_CP035470:32222-32287 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|