Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 26418..26682 | Replicon | plasmid pU12A_B |
| Accession | NZ_CP035469 | ||
| Organism | Escherichia coli strain U12A | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | U12A_RS01160 | Protein ID | WP_001331364.1 |
| Coordinates | 26418..26570 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 26625..26682 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U12A_RS01140 | 21695..23863 | + | 2169 | WP_125075213.1 | DotA/TraY family protein | - |
| U12A_RS01145 | 23937..24587 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| U12A_RS01150 | 24659..24868 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| U12A_RS27475 | 25260..25436 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| U12A_RS01155 | 26095..26346 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| U12A_RS01160 | 26418..26570 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - | 26625..26682 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 26625..26682 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 26625..26682 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 26625..26682 | + | 58 | NuclAT_0 | - | Antitoxin |
| U12A_RS01165 | 26862..28070 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| U12A_RS01170 | 28089..29159 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| U12A_RS01175 | 29152..31443 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..87354 | 87354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T117860 WP_001331364.1 NZ_CP035469:c26570-26418 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T117860 NZ_CP035469:c26570-26418 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT117860 NZ_CP035469:26625-26682 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|