Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 5633..5872 | Replicon | plasmid pU12A_A |
Accession | NZ_CP035468 | ||
Organism | Escherichia coli strain U12A |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | U12A_RS00055 | Protein ID | WP_023144756.1 |
Coordinates | 5633..5767 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 5812..5872 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
U12A_RS00015 | 1644..2045 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
U12A_RS00020 | 1978..2235 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
U12A_RS00025 | 2328..2981 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
U12A_RS00035 | 3921..4778 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
U12A_RS00040 | 4771..4845 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
U12A_RS27650 | 4842..4976 | - | 135 | Protein_7 | protein CopA/IncA | - |
U12A_RS00050 | 5082..5336 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
U12A_RS00055 | 5633..5767 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 5812..5872 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 5812..5872 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 5812..5872 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 5812..5872 | + | 61 | NuclAT_2 | - | Antitoxin |
U12A_RS27465 | 5839..6125 | - | 287 | Protein_10 | DUF2726 domain-containing protein | - |
U12A_RS00065 | 6203..7816 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
U12A_RS00070 | 7847..8197 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
U12A_RS00075 | 8194..8619 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
U12A_RS00085 | 9178..9390 | - | 213 | WP_013023861.1 | hypothetical protein | - |
U12A_RS00090 | 9521..10081 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-1B | senB | 1..151747 | 151747 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T117850 WP_023144756.1 NZ_CP035468:c5767-5633 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T117850 NZ_CP035468:c5767-5633 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT117850 NZ_CP035468:5812-5872 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|