Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 179937..180119 | Replicon | chromosome |
Accession | NZ_CP035369 | ||
Organism | Staphylococcus aureus strain LAC |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ERW10_RS01170 | Protein ID | WP_001801861.1 |
Coordinates | 180024..180119 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 179937..179996 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ERW10_RS01155 | 179075..179452 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
ERW10_RS01160 | 179646..179822 | + | 177 | Protein_177 | transposase | - |
ERW10_RS01165 | 179800..179901 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 179937..179996 | + | 60 | - | - | Antitoxin |
ERW10_RS01170 | 180024..180119 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
ERW10_RS01180 | 180322..180465 | + | 144 | WP_001549059.1 | transposase | - |
ERW10_RS01190 | 181069..181452 | + | 384 | WP_000070811.1 | hypothetical protein | - |
ERW10_RS01195 | 181463..181639 | + | 177 | WP_000375476.1 | hypothetical protein | - |
ERW10_RS01200 | 181641..181826 | + | 186 | WP_000809857.1 | hypothetical protein | - |
ERW10_RS01205 | 181940..182581 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
ERW10_RS01210 | 182799..183350 | - | 552 | WP_000414205.1 | hypothetical protein | - |
ERW10_RS01215 | 183448..183792 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
ERW10_RS01220 | 183833..184459 | - | 627 | Protein_187 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 161417..206145 | 44728 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T117658 WP_001801861.1 NZ_CP035369:c180119-180024 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T117658 NZ_CP035369:c180119-180024 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT117658 NZ_CP035369:179937-179996 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|