Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-symR/Ldr(toxin) |
Location | 4419931..4420152 | Replicon | chromosome |
Accession | NZ_CP035366 | ||
Organism | Escherichia coli O157:H7 strain C1-057 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | ES669_RS22845 | Protein ID | WP_001295224.1 |
Coordinates | 4419931..4420038 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4420087..4420152 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ES669_RS22820 | 4415184..4415936 | - | 753 | Protein_4336 | cellulose biosynthesis protein BcsQ | - |
ES669_RS22825 | 4415948..4416136 | - | 189 | WP_001063316.1 | YhjR family protein | - |
ES669_RS22830 | 4416409..4417980 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
ES669_RS22835 | 4417977..4418168 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
ES669_RS22840 | 4418165..4419844 | + | 1680 | WP_000191592.1 | cellulose biosynthesis protein BcsG | - |
ES669_RS22845 | 4419931..4420038 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4420087..4420152 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4420087..4420152 | + | 66 | NuclAT_21 | - | Antitoxin |
ES669_RS22850 | 4420514..4421785 | + | 1272 | WP_001301684.1 | amino acid permease | - |
ES669_RS22855 | 4421815..4422819 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
ES669_RS22860 | 4422816..4423799 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
ES669_RS22865 | 4423810..4424712 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T117646 WP_001295224.1 NZ_CP035366:c4420038-4419931 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T117646 NZ_CP035366:c4420038-4419931 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT117646 NZ_CP035366:4420087-4420152 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|