Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30014..30283 | Replicon | plasmid pD72-F33 |
| Accession | NZ_CP035314 | ||
| Organism | Escherichia coli strain D72 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ERL60_RS23050 | Protein ID | WP_001312861.1 |
| Coordinates | 30125..30283 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 30014..30079 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ERL60_RS23025 | 25724..26251 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| ERL60_RS23030 | 26309..26542 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| ERL60_RS23035 | 26603..28626 | + | 2024 | Protein_35 | ParB/RepB/Spo0J family partition protein | - |
| ERL60_RS23040 | 28695..29129 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| ERL60_RS23045 | 29126..29845 | + | 720 | WP_131419573.1 | plasmid SOS inhibition protein A | - |
| - | 29857..30081 | + | 225 | NuclAT_0 | - | - |
| - | 29857..30081 | + | 225 | NuclAT_0 | - | - |
| - | 29857..30081 | + | 225 | NuclAT_0 | - | - |
| - | 29857..30081 | + | 225 | NuclAT_0 | - | - |
| ERL60_RS24000 | 29866..30045 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 30014..30079 | + | 66 | - | - | Antitoxin |
| ERL60_RS23050 | 30125..30283 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ERL60_RS24075 | 30521..30898 | - | 378 | Protein_40 | hypothetical protein | - |
| ERL60_RS23070 | 31198..31494 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| ERL60_RS23075 | 31605..32426 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| ERL60_RS23080 | 32723..33370 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| ERL60_RS23085 | 33647..34030 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| ERL60_RS23090 | 34221..34907 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| ERL60_RS23095 | 35001..35228 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / blaCTX-M-55 | - | 1..89963 | 89963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T117602 WP_001312861.1 NZ_CP035314:30125-30283 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T117602 NZ_CP035314:30125-30283 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT117602 NZ_CP035314:30014-30079 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|