Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 2435691..2435839 | Replicon | chromosome |
Accession | NZ_CP035291 | ||
Organism | Staphylococcus haemolyticus strain ATCC 29970 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EQ029_RS11805 | Protein ID | WP_011276848.1 |
Coordinates | 2435691..2435786 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2435804..2435839 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQ029_RS11770 | 2431418..2431651 | + | 234 | WP_016931184.1 | hypothetical protein | - |
EQ029_RS11775 | 2431759..2432076 | - | 318 | Protein_2281 | IS200/IS605-like element ISSep3 family transposase | - |
EQ029_RS12630 | 2432769..2433026 | + | 258 | Protein_2282 | replication initiation protein | - |
EQ029_RS11790 | 2433630..2434160 | + | 531 | WP_011276845.1 | N-acetyltransferase | - |
EQ029_RS11795 | 2434400..2434783 | + | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
EQ029_RS11800 | 2434922..2435226 | + | 305 | Protein_2285 | hypothetical protein | - |
EQ029_RS12635 | 2435350..2435496 | + | 147 | WP_000668388.1 | hypothetical protein | - |
EQ029_RS11805 | 2435691..2435786 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2435804..2435839 | + | 36 | - | - | Antitoxin |
EQ029_RS11810 | 2435980..2436882 | + | 903 | WP_057504751.1 | nucleotidyltransferase | - |
EQ029_RS11815 | 2436886..2437488 | + | 603 | WP_011276850.1 | hypothetical protein | - |
EQ029_RS11820 | 2437632..2437715 | - | 84 | Protein_2290 | ATP-binding protein | - |
EQ029_RS11825 | 2437716..2438252 | - | 537 | WP_057504750.1 | hypothetical protein | - |
EQ029_RS11830 | 2438266..2438847 | - | 582 | WP_011276564.1 | TetR family transcriptional regulator C-terminal domain-containing protein | - |
EQ029_RS11835 | 2439052..2439630 | + | 579 | WP_037559009.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2431756..2432076 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T117551 WP_011276848.1 NZ_CP035291:2435691-2435786 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T117551 NZ_CP035291:2435691-2435786 [Staphylococcus haemolyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT117551 NZ_CP035291:2435804-2435839 [Staphylococcus haemolyticus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|