Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2243147..2243364 | Replicon | chromosome |
Accession | NZ_CP035226 | ||
Organism | Bacillus subtilis strain SRCM103517 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A6H0WKE8 |
Locus tag | EQW70_RS11690 | Protein ID | WP_032721653.1 |
Coordinates | 2243147..2243323 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2243264..2243364 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQW70_RS22205 | 2238440..2238598 | - | 159 | WP_164914267.1 | hypothetical protein | - |
EQW70_RS11630 | 2238633..2238839 | - | 207 | WP_128740466.1 | hypothetical protein | - |
EQW70_RS11635 | 2238868..2239089 | - | 222 | WP_128740467.1 | hypothetical protein | - |
EQW70_RS11640 | 2239076..2239339 | - | 264 | WP_128740468.1 | hypothetical protein | - |
EQW70_RS11645 | 2239354..2239590 | - | 237 | WP_128740469.1 | hypothetical protein | - |
EQW70_RS11650 | 2239590..2239784 | - | 195 | WP_128740470.1 | hypothetical protein | - |
EQW70_RS11655 | 2239820..2240131 | - | 312 | WP_128740471.1 | hypothetical protein | - |
EQW70_RS11660 | 2240156..2240377 | - | 222 | WP_128740472.1 | hypothetical protein | - |
EQW70_RS11665 | 2240533..2240736 | - | 204 | WP_124048602.1 | hypothetical protein | - |
EQW70_RS11670 | 2240800..2241003 | - | 204 | WP_128740473.1 | hypothetical protein | - |
EQW70_RS11675 | 2241345..2242562 | - | 1218 | WP_128740474.1 | hypothetical protein | - |
EQW70_RS11680 | 2242644..2242832 | - | 189 | WP_003230987.1 | hypothetical protein | - |
EQW70_RS11685 | 2242877..2243128 | - | 252 | WP_080010576.1 | hypothetical protein | - |
EQW70_RS11690 | 2243147..2243323 | - | 177 | WP_032721653.1 | hypothetical protein | Toxin |
- | 2243264..2243364 | + | 101 | NuclAT_0 | - | Antitoxin |
- | 2243264..2243364 | + | 101 | NuclAT_0 | - | Antitoxin |
- | 2243264..2243364 | + | 101 | NuclAT_0 | - | Antitoxin |
- | 2243264..2243364 | + | 101 | NuclAT_0 | - | Antitoxin |
EQW70_RS11700 | 2243857..2244468 | - | 612 | WP_128740475.1 | hypothetical protein | - |
EQW70_RS11705 | 2244663..2244989 | - | 327 | WP_128740476.1 | helix-turn-helix domain-containing protein | - |
EQW70_RS11710 | 2245941..2246135 | + | 195 | WP_072692657.1 | hypothetical protein | - |
EQW70_RS11715 | 2246175..2248049 | + | 1875 | Protein_2241 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2173775..2309084 | 135309 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6850.39 Da Isoelectric Point: 12.8833
>T117412 WP_032721653.1 NZ_CP035226:c2243323-2243147 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T117412 NZ_CP035226:c2243323-2243147 [Bacillus subtilis]
GTGCTTGAGAAAGTGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCAGATGA
GTGCTTGAGAAAGTGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCAGATGA
Antitoxin
Download Length: 101 bp
>AT117412 NZ_CP035226:2243264-2243364 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|