Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
Location | 2232187..2232351 | Replicon | chromosome |
Accession | NZ_CP035165 | ||
Organism | Bacillus subtilis strain SRCM103881 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | EQI56_RS11465 | Protein ID | WP_009967548.1 |
Coordinates | 2232187..2232303 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2232298..2232351 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQI56_RS11425 | 2227324..2227716 | + | 393 | WP_019712881.1 | hypothetical protein | - |
EQI56_RS11430 | 2227737..2227988 | + | 252 | WP_019712880.1 | phage holin | - |
EQI56_RS11435 | 2228116..2229252 | + | 1137 | WP_019712879.1 | tetratricopeptide repeat protein | - |
EQI56_RS11440 | 2229242..2229418 | + | 177 | WP_019712878.1 | hypothetical protein | - |
EQI56_RS11445 | 2229415..2230689 | - | 1275 | WP_128472254.1 | Y-family DNA polymerase | - |
EQI56_RS11450 | 2230682..2231014 | - | 333 | WP_109962767.1 | YolD-like family protein | - |
EQI56_RS11455 | 2231188..2231523 | + | 336 | WP_041054825.1 | hypothetical protein | - |
EQI56_RS11460 | 2231567..2231926 | - | 360 | WP_041338710.1 | hypothetical protein | - |
EQI56_RS11465 | 2232187..2232303 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2232298..2232351 | - | 54 | NuclAT_1 | - | Antitoxin |
- | 2232298..2232351 | - | 54 | NuclAT_1 | - | Antitoxin |
- | 2232298..2232351 | - | 54 | NuclAT_1 | - | Antitoxin |
- | 2232298..2232351 | - | 54 | NuclAT_1 | - | Antitoxin |
EQI56_RS11470 | 2232395..2232853 | - | 459 | WP_109962768.1 | SMI1/KNR4 family protein | - |
EQI56_RS11475 | 2232866..2234752 | - | 1887 | WP_109962769.1 | HNH endonuclease | - |
EQI56_RS11480 | 2234885..2235418 | - | 534 | WP_109962770.1 | SMI1/KNR4 family protein | - |
EQI56_RS11485 | 2235503..2235753 | - | 251 | Protein_2189 | hypothetical protein | - |
EQI56_RS11490 | 2235933..2236817 | + | 885 | WP_109962771.1 | endonuclease YokF | - |
EQI56_RS11495 | 2236860..2237333 | - | 474 | WP_109962772.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2116141..2264885 | 148744 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T117278 WP_009967548.1 NZ_CP035165:2232187-2232303 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T117278 NZ_CP035165:2232187-2232303 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 54 bp
>AT117278 NZ_CP035165:c2232351-2232298 [Bacillus subtilis]
AAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAAACTCAAGGGAAGGTCTATTT
AAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAAACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|