Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4565508..4565733 | Replicon | chromosome |
Accession | NZ_CP034935 | ||
Organism | Shigella dysenteriae strain 79-8006 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | EPD85_RS24075 | Protein ID | WP_000813254.1 |
Coordinates | 4565578..4565733 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4565508..4565566 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EPD85_RS24035 | 4560871..4561293 | + | 423 | WP_001151146.1 | DUF977 family protein | - |
EPD85_RS24040 | 4561290..4561595 | + | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
EPD85_RS24045 | 4561582..4562037 | + | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
EPD85_RS24050 | 4562087..4563625 | - | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
EPD85_RS24055 | 4563674..4564021 | - | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
EPD85_RS24060 | 4564018..4564398 | - | 381 | WP_001333468.1 | transposase | - |
EPD85_RS24065 | 4564510..4564926 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 4565508..4565566 | - | 59 | - | - | Antitoxin |
EPD85_RS24075 | 4565578..4565733 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
EPD85_RS24080 | 4565901..4566179 | + | 279 | WP_000929754.1 | hypothetical protein | - |
EPD85_RS24085 | 4566181..4566930 | + | 750 | Protein_4582 | hypothetical protein | - |
EPD85_RS24090 | 4566980..4567908 | - | 929 | Protein_4583 | IS3-like element IS600 family transposase | - |
EPD85_RS25450 | 4568677..4568745 | + | 69 | Protein_4585 | phage tail protein | - |
EPD85_RS24100 | 4568748..4569293 | + | 546 | WP_000902849.1 | tail fiber assembly protein | - |
EPD85_RS24105 | 4569317..4570585 | + | 1269 | Protein_4587 | prophage tail fiber N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 4554958..4595447 | 40489 | |
- | inside | IScluster/Tn | - | - | 4557048..4568301 | 11253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T116990 WP_000813254.1 NZ_CP034935:4565578-4565733 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116990 NZ_CP034935:4565578-4565733 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116990 NZ_CP034935:c4565566-4565508 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|