Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2955717..2955974 | Replicon | chromosome |
Accession | NZ_CP034935 | ||
Organism | Shigella dysenteriae strain 79-8006 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | Q31V67 |
Locus tag | EPD85_RS15895 | Protein ID | WP_001135724.1 |
Coordinates | 2955717..2955869 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2955920..2955974 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EPD85_RS15865 | 2951121..2951708 | + | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
EPD85_RS15870 | 2951812..2952786 | + | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
EPD85_RS15875 | 2952836..2953546 | - | 711 | WP_004987320.1 | DUF3053 domain-containing protein | - |
EPD85_RS15880 | 2953803..2954500 | + | 698 | WP_134795416.1 | IS1-like element IS1SD family transposase | - |
EPD85_RS15885 | 2954755..2955045 | + | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
EPD85_RS15890 | 2955326..2955538 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
EPD85_RS25285 | 2955669..2955728 | + | 60 | WP_212732943.1 | hypothetical protein | - |
EPD85_RS15895 | 2955717..2955869 | - | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 2955920..2955974 | + | 55 | - | - | Antitoxin |
EPD85_RS15900 | 2956133..2956830 | + | 698 | WP_094106546.1 | IS1 family transposase | - |
EPD85_RS15905 | 2957134..2958362 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
EPD85_RS15910 | 2958376..2959518 | - | 1143 | Protein_2977 | IS4-like element IS4 family transposase | - |
EPD85_RS15915 | 2959669..2960025 | + | 357 | WP_000239757.1 | transposase | - |
EPD85_RS15920 | 2960022..2960231 | + | 210 | Protein_2979 | IS66 family insertion sequence element accessory protein TnpB | - |
EPD85_RS15925 | 2960235..2960465 | + | 231 | Protein_2980 | IS4 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 2954123..2960025 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T116983 WP_001135724.1 NZ_CP034935:c2955869-2955717 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T116983 NZ_CP034935:c2955869-2955717 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT116983 NZ_CP034935:2955920-2955974 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|