Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1971923..1972181 | Replicon | chromosome |
Accession | NZ_CP034935 | ||
Organism | Shigella dysenteriae strain 79-8006 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | EPD85_RS11040 | Protein ID | WP_000809168.1 |
Coordinates | 1972029..1972181 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 1971923..1971980 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EPD85_RS11025 | 1968840..1969274 | + | 435 | Protein_2038 | fimbrial family protein | - |
EPD85_RS11030 | 1969312..1970211 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
EPD85_RS11035 | 1970277..1971443 | - | 1167 | WP_000681373.1 | Na+/H+ antiporter NhaA | - |
- | 1971923..1971980 | - | 58 | - | - | Antitoxin |
EPD85_RS11040 | 1972029..1972181 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
EPD85_RS11045 | 1972285..1973400 | - | 1116 | WP_001118451.1 | molecular chaperone DnaJ | - |
EPD85_RS11050 | 1973489..1975405 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
EPD85_RS11055 | 1975782..1976012 | + | 231 | Protein_2044 | DUF2541 family protein | - |
EPD85_RS11060 | 1976067..1976764 | + | 698 | WP_094106546.1 | IS1 family transposase | - |
EPD85_RS11065 | 1976787..1976963 | + | 177 | Protein_2046 | DUF2541 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1976261..1976764 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T116981 WP_000809168.1 NZ_CP034935:1972029-1972181 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T116981 NZ_CP034935:1972029-1972181 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT116981 NZ_CP034935:c1971980-1971923 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|