Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 712500..712725 | Replicon | chromosome |
Accession | NZ_CP034935 | ||
Organism | Shigella dysenteriae strain 79-8006 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | EPD85_RS04555 | Protein ID | WP_000813254.1 |
Coordinates | 712500..712655 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 712667..712725 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EPD85_RS04520 | 707802..708860 | - | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
EPD85_RS04525 | 708968..709208 | - | 241 | Protein_771 | hypothetical protein | - |
EPD85_RS04530 | 709434..710255 | - | 822 | WP_000762933.1 | antitermination protein | - |
EPD85_RS04535 | 710252..710626 | - | 375 | WP_073817556.1 | RusA family crossover junction endodeoxyribonuclease | - |
EPD85_RS04540 | 710639..711685 | - | 1047 | WP_001265091.1 | DUF968 domain-containing protein | - |
EPD85_RS04545 | 711687..711965 | - | 279 | WP_032335658.1 | hypothetical protein | - |
EPD85_RS04550 | 712032..712283 | - | 252 | WP_000980988.1 | protein Rem | - |
EPD85_RS04555 | 712500..712655 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 712667..712725 | + | 59 | - | - | Antitoxin |
EPD85_RS04560 | 712947..713180 | - | 234 | WP_000350274.1 | hypothetical protein | - |
EPD85_RS24705 | 714623..714790 | - | 168 | WP_000207997.1 | hypothetical protein | - |
EPD85_RS04570 | 714801..715064 | - | 264 | WP_000224216.1 | hypothetical protein | - |
EPD85_RS04575 | 715066..715284 | - | 219 | WP_001142588.1 | DUF4014 family protein | - |
EPD85_RS04580 | 715286..715501 | - | 216 | WP_000510387.1 | hypothetical protein | - |
EPD85_RS04585 | 715502..715861 | - | 360 | WP_001289986.1 | hypothetical protein | - |
EPD85_RS24710 | 715858..716034 | - | 177 | WP_000753053.1 | hypothetical protein | - |
EPD85_RS04590 | 716027..716209 | - | 183 | WP_001224665.1 | hypothetical protein | - |
EPD85_RS04595 | 716305..716661 | - | 357 | WP_000403782.1 | hypothetical protein | - |
EPD85_RS04600 | 716639..717100 | - | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
EPD85_RS04605 | 717097..717393 | - | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 673971..750164 | 76193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T116978 WP_000813254.1 NZ_CP034935:c712655-712500 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116978 NZ_CP034935:c712655-712500 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116978 NZ_CP034935:712667-712725 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|