Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1373528..1373753 | Replicon | chromosome |
Accession | NZ_CP034931 | ||
Organism | Shigella flexneri strain 2013C-3749 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | EPD86_RS06860 | Protein ID | WP_000813254.1 |
Coordinates | 1373598..1373753 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1373528..1373586 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EPD86_RS06820 | 1368705..1369967 | - | 1263 | Protein_1322 | tyrosine-type recombinase/integrase | - |
EPD86_RS06830 | 1370305..1371102 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
EPD86_RS06840 | 1371313..1372363 | - | 1051 | Protein_1324 | tyrosine-type recombinase/integrase | - |
EPD86_RS06845 | 1372363..1372503 | - | 141 | Protein_1325 | DUF4224 domain-containing protein | - |
EPD86_RS06850 | 1372530..1372946 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 1373528..1373586 | - | 59 | - | - | Antitoxin |
EPD86_RS06860 | 1373598..1373753 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
EPD86_RS06865 | 1373921..1374199 | + | 279 | WP_011069426.1 | hypothetical protein | - |
EPD86_RS06870 | 1374201..1375259 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
EPD86_RS06875 | 1375260..1375625 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
EPD86_RS06880 | 1375622..1376310 | + | 689 | Protein_1331 | bacteriophage antitermination protein Q | - |
EPD86_RS06905 | 1377106..1377321 | + | 216 | WP_000839572.1 | class II holin family protein | - |
EPD86_RS06910 | 1377420..1378094 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
EPD86_RS06915 | 1378091..1378441 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 1364144..1406380 | 42236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T116940 WP_000813254.1 NZ_CP034931:1373598-1373753 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116940 NZ_CP034931:1373598-1373753 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116940 NZ_CP034931:c1373586-1373528 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|