Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4776843..4777068 | Replicon | chromosome |
| Accession | NZ_CP034808 | ||
| Organism | Escherichia coli strain 08-3914 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | AYP36_RS24075 | Protein ID | WP_000813258.1 |
| Coordinates | 4776913..4777068 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4776843..4776901 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYP36_RS24025 | 4771908..4772150 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| AYP36_RS24030 | 4772134..4772559 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| AYP36_RS24035 | 4772628..4773671 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| AYP36_RS24040 | 4773664..4774125 | + | 462 | WP_000139447.1 | replication protein | - |
| AYP36_RS24045 | 4774159..4774875 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| AYP36_RS24050 | 4774908..4775189 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| AYP36_RS24055 | 4775186..4775413 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| AYP36_RS24060 | 4775406..4775717 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| AYP36_RS24065 | 4775845..4776063 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| AYP36_RS24070 | 4776065..4776622 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 4776843..4776901 | - | 59 | - | - | Antitoxin |
| AYP36_RS24075 | 4776913..4777068 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AYP36_RS24080 | 4777188..4777532 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| AYP36_RS24085 | 4777654..4777926 | + | 273 | WP_000191870.1 | hypothetical protein | - |
| AYP36_RS24090 | 4777928..4778977 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| AYP36_RS24095 | 4778990..4779295 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYP36_RS24100 | 4779358..4779912 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| AYP36_RS24105 | 4780137..4780334 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| AYP36_RS24110 | 4780470..4781183 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| AYP36_RS24125 | 4781638..4782066 | + | 429 | WP_001303509.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 4702017..4832200 | 130183 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T116858 WP_000813258.1 NZ_CP034808:4776913-4777068 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T116858 NZ_CP034808:4776913-4777068 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT116858 NZ_CP034808:c4776901-4776843 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|